Background: The results of operations are not planned for bone sarcomas has not often discussed. However, it is important to recognize patterns, treatment, and clinical outcome of the operation was not planned for patients with bone sarcomas. The aim of this multicenter study to characterize the clinical outcome of patients with bone sarcoma who undergo planned operations.
Patients and methods: Data from 43 patients with bone sarcoma who undergo planned operations between 2006 and 2017 was obtained from 23 hospitals in Japan. These included 18 cases of osteosarcoma, Ewing sarcoma of 9, 8 of chondrosarcoma, and 6 undifferentiated pleomorphic sarcoma. The study involved 28 men and 15 women, with an average age of 46 years. The duration of the average follow-up was 59 months.
Results: The main primary tumor sites are the femur (n = 19), spine (n = 6), pelvis (n = 5), the tibia (n = 3), and humerus (n = 3). Diagnosis principal is benign bone tumors (n = 24), trauma (n = 7), bone metastases (n = 5), osteomyelitis (n = 4), degeneration (n = 2), and unknown (n = 1). As unplanned surgery, curettage, with or without bone graft, performed in 26 patients; Internal fixation is done at 7; spine surgery at 5; arthroplasty in 4; and arthroscopy in one.
Thirty-eight patients received standard treatments extra. Thirty-four patients underwent surgical resection of the tumor, including amputation (n = 10), and the remaining 4 receive radiotherapy or carbon ion radiotherapy for the treatment of additional standards. Level 5-year disease-specific survival (DSS) in patients with osteosarcoma, Ewing sarcoma, and chondrosarcoma was 65.5%, 58.3% and 72.9%, respectively. Twelve patients (27.9%) developed local recurrence (LR); among a total of 43 patients studied, the level of 5-year DSS was significantly worse for those who develop LR compared with those who did not (p = 0.03). 5-year DSS levels in patients with and without LR was 44% and 73.8%, respectively.
Conclusions: We recommend that patients undergoing surgery underwent unplanned given standard treatment, including the option to amputation because here, LR proved to be a risk factor for decreased DSS.
The Pathogenesis and Prevention Port-Site Metastasis in Gynecologic Oncology
Port-site metastases (PSM) is a specific and challenging complications of laparoscopic gynecologic oncology procedures. Research has shown that PSM is associated with morbidity and poor results. The exact pathogenesis of PSM in gynecological patients is not clear. Some precautions of PSM has been discussed in the relevant literature, and novel approaches to prevent this complication rarely keep up. In this review, we summarize the potential mechanisms of PSM and discuss the controversy and benefits of measures proposed prevention of PSM in gynecologic oncology.
We conducted a literature search using Medline database to identify studies of the pathogenesis and prevention of laparoscopic PSM. The hypothesis of the pathogenesis PSM at the center of the body’s immune response, pneumoperitoneum, contamination of wounds and surgical methods. convincing evidence of effective prevention of PSM after laparoscopic surgery is less. traditional preventive measures such as irrigation and tumor manipulation must be taken individually.
CO2 insufflation Hyperthermic and humidified CO2 leads to better outcomes in patients with malignant tumors who underwent laparoscopic procedures with the CO2 pneumoperitoneum than normal. Port-resection site showed no advantage in survival and outcome in the event of more injuries. PSM prevention plays an important part in the overall care of patients with gynecological malignancies who underwent laparoscopic procedures.

End of the decision on the limitation of treatment in patients with cancer: an empirical analysis of the end-of-life practice of hematology and oncology unit at a university hospital in Germany
Background: The decision to limit treatment (DLTs) were essential to protect patients from overtreatment but it is one of the most ethically challenging situations in the practice of oncology. Ethics Policy Planning in Advance Care and Treatment study Limiting (EPAL), we examined how often DLT preceded the death of the patient and how early they were determined before (T1) and after (T2) the implementation of ethics policies intrainstitutional in DLT.
Methods: This prospective quantitative recruited 1,134 patients with hematology / oncology neoplasia within a period of 2 × 6 months at the Hospital of the University of Munich, Germany. Information on admission, discharge, diagnosis, age, DLT, date and place of death, and the time span between the initial determination of the DLT and the death of a patient are recorded using a standard form.
Results: Overall, 21% (n = 236) of the 1,134 patients, DLT was made. After the implementation of the policy, the proportion of reduction (26% T1 / T2 16%). However, the decision was more comprehensive, including more frequent combinations of ‘Do Not Resuscitate’ and ‘no intensive care unit’ (44% T1 / T2 64%). The median time between the determination of DLT and the patient’s death is equally short with 6 days in regular wards (each T1 / T2) and 10.5 / 9 (T1 / T2) days in the palliative care unit. For patients with solid tumors, DLTs made earlier in both routine and palliative care units than the deceased with hematologic neoplasia.
Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated |
|||
A12001 | EpiGentek |
|
|
Goat Anti-Rat Secondary Antibody, Biotin Conjugated |
|||
A12002 | EpiGentek |
|
|
Human Genomic DNA |
|||
X11000 | EpiGentek |
|
|
Human Brain Genomic DNA |
|||
X11001 | EpiGentek |
|
|
Anti-Flt-4 Antibody |
|||
A01276-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Flt-4 Antibody (FLT4) detection.tested for IHC, WB in Human, Mouse, Rat. |
Mouse FLT-4/VEGFR-3 Control/blocking peptide #1 |
|||
FLT41-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
Rabbit Anti-human FLT-1/VEGFR-1 IgG #1, aff pure |
|||
FLT11-A | Alpha Diagnostics | 100 ul | EUR 578.4 |
Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure |
|||
FLT12-M | Alpha Diagnostics | 100 ug | EUR 578.4 |
Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure |
|||
FLT14-M | Alpha Diagnostics | 100 ug | EUR 578.4 |
Histone H3 Methylation Antibody Panel Pack I – Active Genes |
|||
C10000 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack I – Repression Genes |
|||
C10001 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Active Genes |
|||
C10002 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Repression Genes |
|||
C10003 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack III – Active Genes |
|||
C10004 | EpiGentek |
|
|
Histone H3K4 Methylation Antibody Panel Pack |
|||
C10005 | EpiGentek |
|
|
Histone H3K9 Methylation Antibody Panel Pack |
|||
C10006 | EpiGentek |
|
|
Histone H3K27 Methylation Antibody Panel Pack |
|||
C10007 | EpiGentek |
|
|
Histone H3K36 Methylation Antibody Panel Pack |
|||
C10008 | EpiGentek |
|
|
Histone H3K79 Methylation Antibody Panel Pack |
|||
C10009 | EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack I |
|||
C10010 | EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack II |
|||
C10011 | EpiGentek |
|
|
Histone H4K20 Methylation Antibody Panel Pack |
|||
C10012 | EpiGentek |
|
|
Histone H4 Acetylation Antibody Panel Pack |
|||
C10013 | EpiGentek |
|
|
Histone H3 Phosphorylation Antibody Panel Pack |
|||
C10014 | EpiGentek |
|
|
Histone H3R2 Methylation Antibody Panel Pack |
|||
C10015 | EpiGentek |
|
|
Histone H3R8 Methylation Antibody Panel Pack |
|||
C10016 | EpiGentek |
|
|
Histone H3R17 Methylation Antibody Panel Pack |
|||
C10017 | EpiGentek |
|
|
Histone H3R26 Methylation Antibody Panel Pack |
|||
C10018 | EpiGentek |
|
|
Histone H4R3 Methylation Antibody Panel Pack |
|||
C10019 | EpiGentek |
|
|
DNMT3A Protein |
|||
E11000 | EpiGentek |
|
|
TET1 Protein (Active) |
|||
E12002 | EpiGentek |
|
|
DNMT3B Protein |
|||
E14000 | EpiGentek |
|
|
DNMT1 Protein |
|||
E15000 | EpiGentek |
|
|
HDAC1 Protein |
|||
E24002 | EpiGentek |
|
|
HDAC10 Protein |
|||
E24003 | EpiGentek |
|
|
HDAC11 Protein |
|||
E24004 | EpiGentek |
|
|
HDAC2 Protein |
|||
E24005 | EpiGentek |
|
|
HDAC3 Protein |
|||
E24006 | EpiGentek |
|
|
HDAC4 Protein |
|||
E24007 | EpiGentek |
|
|
HDAC5 Protein |
|||
E24008 | EpiGentek |
|
|
HDAC6 Protein |
|||
E24009 | EpiGentek |
|
|
HDAC7 Protein |
|||
E24010 | EpiGentek |
|
|
HDAC8 Protein |
|||
E24011 | EpiGentek |
|
|
HDAC9 Protein |
|||
E24012 | EpiGentek |
|
|
H3F3A Protein |
|||
E35003 | EpiGentek |
|
|
H4 Protein |
|||
E35005 | EpiGentek |
|
|
SOD1 Protein |
|||
E70000 | EpiGentek |
|
|
EpiMag HT (96-Well) Magnetic Separator |
|||
Q10002 | EpiGentek |
|
|
EpiMag 96-Well Microplate (5/pack) |
|||
Q10003 | EpiGentek |
|
|
DNA Methylation Antibody Panel Pack I |
|||
C20000 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD Protein, Human Fc-Fusion, Avi-Tag |
|||
E80025 | EpiGentek |
|
|
VEGFR-2, human recombinant protein |
|||
P1080-.1 | ApexBio | 100 µg | EUR 2314.8 |
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity |
Human FLT-4/VEGFR-3 control/blocking peptide #2 |
|||
FLT42-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
ACE2, His-Tag Protein |
|||
E80019 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 (13-665) Protein, Fc Fusion, Avi-tag |
|||
E80020 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 (16-685) Protein, Avi-His-tag |
|||
E80021 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 (16-685) Protein, Fc Fusion, Avi-tag |
|||
E80022 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD (V367F) Protein, Avi-His-tag |
|||
E80023 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD Protein, Avi-His-tag |
|||
E80024 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD Protein, Mouse Fc-fusion |
|||
E80026 | EpiGentek |
|
|
SARS-CoV-2 Nucleocapsid Protein, Avi-His-tag |
|||
E80027 | EpiGentek |
|
|
Recombinant SARS-CoV-2 Spike Glycoprotein(S) (D614G), Partial |
|||
E80028 | EpiGentek |
|
|
Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure |
|||
FLT15-A | Alpha Diagnostics | 100 ul | EUR 578.4 |
Amyloid ?-Peptide (1-42) (human) |
|||
B6057-.1 | ApexBio | 100 ug | EUR 331.2 |
Polyclonal Goat anti-GST α-form |
|||
GST-ANTI-1 | Detroit R&D | 50 uL | EUR 336 |
VEGFR Tyrosine Kinase Inhibitor II |
|||
C4603-1 | ApexBio | 1 mg | EUR 141.6 |
Rabbit Anti-Mouse FLT-4/VEGFR-3 IgG #1, aff pure |
|||
FLT41-A | Alpha Diagnostics | 100 ug | EUR 578.4 |
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-1 | ApexBio | 1 mg | EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Brain natriuretic peptide (1-32) (human) |
|||
B5442-1 | ApexBio | 1 mg | EUR 621.6 |
Methylamp 96 DNA Modification Kit |
|||
P-1008 | EpiGentek |
|
|
EpiQuik Nuclear Extraction Kit |
|||
OP-0002 | EpiGentek |
|
|
Nucleic Acid Isolation Enhancer (Glycogen Solution) |
|||
R-1001 | EpiGentek |
|
|
Methylamp PCR Enhancer |
|||
R-1002 | EpiGentek |
|
|
Streptavidin: HRP Conjugate |
|||
R-1098 | EpiGentek |
|
|
Streptavidin |
|||
R-1100 | EpiGentek |
|
|
Protease Inhibitor Cocktail |
|||
R-1101 | EpiGentek |
|
|
Streptavidin-Coated Strip Microwell Plate (Flat) |
|||
R-1102 | EpiGentek |
|
|
DNA High Binding Solution |
|||
R-1103 | EpiGentek |
|
|
DTT Solution |
|||
R-1104 | EpiGentek |
|
|
GnRH Associated Peptide (GAP) (1-13), human |
|||
A1020-1 | ApexBio | 1 mg | EUR 108 |
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP). |
HIV-1 Tat Protein Peptide |
|||
B1433-1 | ApexBio | 1 mg | EUR 153.6 |
Description: HIV-1 Tat Protein Peptide |
Anti-Flt-1 antibody |
|||
STJ93093 | St John's Laboratory | 200 µl | EUR 236.4 |
Description: Rabbit polyclonal to Flt-1. |
Anti-Flt-1 antibody |
|||
STJ93094 | St John's Laboratory | 200 µl | EUR 236.4 |
Description: Rabbit polyclonal to Flt-1. |
Anti-Flt-1 antibody |
|||
STJ98080 | St John's Laboratory | 100 µl | EUR 280.8 |
Description: Mouse monoclonal to Flt-1. |
GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein |
|||
PROTP01275-1 | BosterBio | Regular: 50ug | EUR 380.4 |
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques. |
VEGFR-KDR/Flk-1 Antagonist Peptide |
|||
H-5896.0001 | Bachem | 1.0mg | EUR 691.2 |
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net |
VEGFR-KDR/Flk-1 Antagonist Peptide |
|||
H-5896.0005 | Bachem | 5.0mg | EUR 2648.4 |
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net |
Recombinant Transmembrane Protease Serine 2 Protein, Partial |
|||
E80016 | EpiGentek |
|
|
Recombinant TMPRSS2 Protein, Partial |
|||
E80017 | EpiGentek |
|
|
Recombinant Novel Coronavirus Spike Glycoprotein(S), Partial |
|||
E80018 | EpiGentek |
|
|
YAP-TEAD Inhibitor 1 (Peptide 17) |
|||
A1149-1 | ApexBio | 1 mg | EUR 282 |
C-type natriuretic peptide (1-22) (human, rat, swine) |
|||
B5441-1 | ApexBio | 1 mg | EUR 331.2 |
Anti-human PD-1, PE-labeled |
|||
71290-1 | BPS Bioscience | 50 µg | EUR 355 |
Description: R-Phycoerythrin-labeled anti-PD-1 neutralizing recombinant murine/human chimeric antibody recognizing the PD-L1/PD-L2 binding region of human PD-1. This antibody does not cross-react with mouse PD-1, but does cross-react with monkey (M. fascicularis) PD-1. It has not been tested with other species. |
Rabbit Anti-Human FLT-4/VEGFR-3 IgG #2, aff pure |
|||
FLT42-A | Alpha Diagnostics | 100 ug | EUR 578.4 |
Histone H4 peptide (1-21), Biotin-labeled |
|||
52018-1 | BPS Bioscience | 2.5 nmole | EUR 90 |
Description: Histone H4 peptide, amino acids 1 to 21, acetylated at the N-terminus and biotinylated on the side chain of Lys. A GG spacer has been added on the C-terminus of Lys. |
Lytic Peptide, Shiva ? 1 |
|||
SP-88327-1 | Alpha Diagnostics | 1 mg | EUR 416.4 |
Anti-EDG-1 Antibody |
|||
A01502-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat. |
Anti-ROBO-1 Antibody |
|||
A01530-1 | BosterBio | 100ug | EUR 546 |
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat. |
Anti-Bag-1 Antibody |
|||
A02423-1 | BosterBio | 50 ul | EUR 476.4 |
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat. |
Anti-TUB 1 Antibody |
|||
A02917-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-Dok-1 Antibody |
|||
A03039-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Dok-1 Antibody (DOK1) detection.tested for WB in Human, Mouse, Rat. |
Anti-TFIIIB90-1 Antibody |
|||
A03761-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for TFIIIB90-1 Antibody (BRF1) detection.tested for WB in Human, Mouse. |
Anti-Atrophin-1 Antibody |
|||
A03828-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Atrophin-1 Antibody (ATN1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-CNG-1 Antibody |
|||
A05494-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for CNG-1 Antibody (CNGA1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-Periphilin 1 Antibody |
|||
A06996-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse. |
Anti-Lyl-1 Antibody |
|||
A07491-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat. |
Anti-GLI-1 Antibody |
|||
A07972-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-Cerebellin 1 Antibody |
|||
A09176-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-DOC-1 Antibody |
|||
A09467-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for DOC-1 Antibody (CDK2AP1) detection. Tested with WB in Human, Mouse. |
Anti-NPDC-1 Antibody |
|||
A12846-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for NPDC-1 Antibody (NPDC1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-PAI-1 Antibody |
|||
A00637-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat. |
Anti-Flk-1 Antibody |
|||
A00901-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse. |
Anti-PARP-1 Antibody |
|||
A00122-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse. |
Anti-Presenilin 1 Antibody |
|||
A00138-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat. |
Anti-Apaf-1 (human) Monoclonal Antibody (2E12) |
|||
M00889-1 | BosterBio | 100ug | EUR 518.4 |
Description: Rat Monoclonal Apaf-1 (human) Antibody (2E12). Validated in ELISA, IP, IF, WB and tested in Human. |
Anti-Peptide YY/PYY Antibody |
|||
A04223-1 | BosterBio | 100ug/vial | EUR 400.8 |
VEGFR-1 Antibody |
|||
48347-100ul | SAB | 100ul | EUR 399.6 |
VEGFR-1 Antibody |
|||
48347-50ul | SAB | 50ul | EUR 286.8 |
Anti-HO-1 Monoclonal Antibody (HO-1-2) |
|||
M00253-1 | BosterBio | 1mg | EUR 476.4 |
Description: Mouse Monoclonal HO-1 Antibody (HO-1-2). Validated in Flow Cytometry, IHC, WB and tested in Human, Mouse, Rat. |
Human/Rat/Mouse PLP104-117 peptide, depalmitoylated |
|||
PLP104-1-1 | Alpha Diagnostics | 1 mg | EUR 169.2 |
Human/Rat/Mouse PLP178-191 peptide, depalmitoylated |
|||
PLP178-1-1 | Alpha Diagnostics | 1 mg | EUR 169.2 |
Human/Rat/Mouse PLP40-59 peptide, depalmitoylated |
|||
PLP40-1-1 | Alpha Diagnostics | 1 mg | EUR 169.2 |
Anti-Neurexin 1/NRXN1 Antibody |
|||
A01490-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Hexokinase 1/HK1 Antibody |
|||
A01504-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Synaptotagmin 1/SYT1 Antibody |
|||
A02314-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Syntenin-1 Monoclonal Antibody |
|||
A02475-1 | BosterBio | 100ul | EUR 476.4 |
Description: Mouse Monoclonal Antibody for Syntenin-1 Antibody (SDCBP) detection. Tested with WB in Human, Rat, Dog, Pig. |
Anti-Dsg1/Desmoglein 1 Antibody |
|||
A02655-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Dsg1 Antibody (DSG1) detection.tested for IHC, WB in Human, Mouse, Rat. |
Anti-CAF-1 p150 Antibody |
|||
A02732-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for CAF-1 p150 Antibody (CHAF1A) detection. Tested with WB in Human, Mouse. |
Anti-Talin 1/TLN1 Antibody |
|||
A02859-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Islet 1/ISL1 Antibody |
|||
A02969-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Musashi 1/Msi1 Antibody |
|||
A05052-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Pyrophosphatase 1/PPA1 Antibody |
|||
A07485-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-TCP-1 eta Antibody |
|||
A08169-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for TCP-1 eta Antibody (CCT7) detection. Tested with WB in Human, Mouse, Rat. |
Anti-Relaxin 1/RLN1 Antibody |
|||
A08367-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-TCP-1 zeta Antibody |
|||
A09373-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for TCP-1 zeta Antibody (CCT6A) detection.tested for WB in Human, Mouse, Rat. |
Anti-Galectin 1/Lgals1 Antibody |
|||
A00470-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-LOX-1/OLR1 Antibody |
|||
A00760-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-Syndecan-1/SDC1 Antibody |
|||
A00991-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-IRAK-1/IRAK1 Antibody |
|||
A01021-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-CHST8/Galnac4St 1 Antibody |
|||
A10989-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal CHST8/Galnac4St 1 Antibody. Validated in WB and tested in Human, Mouse, Rat. |
Anti-TNF Receptor 1 Antibody |
|||
A00294-1 | BosterBio | 200ug | EUR 626.4 |
Description: Rabbit Polyclonal TNF Receptor 1 Antibody. Validated in IP, IHC, WB and tested in Human, Mouse, Rat. |
Anti-Galectin 1 Monoclonal Antibody |
|||
M00470-1 | BosterBio | 100ug | EUR 476.4 |
Description: Rabbit Monoclonal Galectin 1 Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat. |
Anti-DJ-1 Monoclonal Antibody |
|||
M00757-1 | BosterBio | 100ul | EUR 476.4 |
Description: Mouse Monoclonal DJ-1 Antibody. Validated in IHC, WB and tested in Bovine, Human. |
Anti-Enolase 1 Monoclonal Antibody |
|||
M01250-1 | BosterBio | 100ul | EUR 476.4 |
Description: Anti-Enolase 1 Monoclonal Antibody tested in WB, IF, ICC, IHC, reactive to Human, rat, mouse, cow, pig, horse |
Anti-Dynamin 1 Monoclonal Antibody |
|||
M02536-1 | BosterBio | 100ug | EUR 476.4 |
Description: Rabbit Monoclonal Dynamin 1 Antibody. Validated in IF, WB and tested in Human, Mouse, Rat. |
Anti-Esrp-1 Monoclonal Antibody |
|||
M06068-1 | BosterBio | 100uL | EUR 531.6 |
Description: Mouse Monoclonal Esrp-1 Antibody. Validated in WB and tested in Human. |
Anti-Presenilin 1 Monoclonal Antibody |
|||
M00138-1 | BosterBio | 100ug | EUR 476.4 |
Description: Rabbit Monoclonal Presenilin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat. |
Anti-Angiopoietin 1/ANGPT1 Antibody |
|||
PA1333-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Galectin 1/LGALS1 Antibody |
|||
PB9240-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-PD-1 Agonistic Antibody |
|||
101178-1 | BPS Bioscience | 50 µg | EUR 335 |
Description: Anti-PD-1 IgG antibody is a purified recombinant antibody which recognizes human PD1 antigen. This antibody has been functionally tested in two co-culture assays. |
Anti-P-glycoprotein (human) Monoclonal Antibody (JSB-1) |
|||
M00049-1 | BosterBio | 125ug | EUR 703.2 |
Description: Mouse Monoclonal P-glycoprotein (human) Antibody (JSB-1). Validated in IF and tested in Human. |
Mouse FLK-1/VEGFR-2 control/blocking peptide # 1 |
|||
FLK11-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
Human/Rat/Mouse PLP139-151 (S140) peptide, depalmitoylated |
|||
PLP139-1-1 | Alpha Diagnostics | 1 mg | EUR 169.2 |
VEGFR-1/Flt1/ Rat VEGFR- 1/ Flt1 ELISA Kit |
|||
ELA-E0147r | Lifescience Market | 96 Tests | EUR 1063.2 |
Human Vascuar endothelial cell growth factor receptor 3, VEGFR-3/Flt-4 ELISA Kit |
|||
1-CSB-E04765h | Cusabio |
|
|
Description: Quantitative sandwich ELISA kit for measuring Human Vascuar endothelial cell growth factor receptor 3, VEGFR-3/Flt-4 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Endothelin-1 (1-15), amide, human |
|||
A1111-1 | ApexBio | 1 mg | EUR 866.4 |
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis. |
Haptoglobin, (Phenotype 1-1) Human Plasma |
|||
7536-1 | Biovision | each | EUR 385.2 |
AXMIR-1 RNA oligo anti-miRNA-1-3p with Xmotif |
|||
AXMIR-1 | SBI | 10 reactions | EUR 525.6 |
Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 |
|||
M04431-1 | BosterBio | 100uL | EUR 462 |
Description: Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 tested in WB, IHC, reactive to Human |
Anti-HLA-G (human) Monoclonal Antibody (MEM-G/1) |
|||
M01235-1 | BosterBio | 100ug | EUR 476.4 |
Description: Mouse Monoclonal HLA-G (human) Antibody (MEM-G/1). Validated in IHC, WB and tested in Human. |
Anti-Liver Carboxylesterase 1/CES1 Antibody |
|||
A01741-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-EBP50/NHERF-1/SLC9A3R1 Antibody |
|||
A02427-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-IL1R2/Il 1 Rii Antibody |
|||
A03106-1 | BosterBio | 1 ml | EUR 476.4 |
Description: Rabbit Polyclonal IL1R2/Il 1 Rii Antibody. Validated in IP, WB and tested in Human. |
Anti-Hyaluronan synthase 1/HAS1 Antibody |
|||
A04784-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-CELSR3/Flamingo Homolog 1 Antibody |
|||
A07204-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal CELSR3/Flamingo Homolog 1 Antibody. Validated in IF and tested in Human, Mouse, Rat. |
Anti-LPCAT2/Acyltransferase Like 1 Antibody |
|||
A07471-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal LPCAT2/Acyltransferase Like 1 Antibody. Validated in WB and tested in Human, Mouse, Rat. |
Anti-VEGF Receptor 1/FLT1 Antibody |
|||
A00534-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-HIF-1 alpha/HIF1A Antibody |
|||
A00013-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-Cleaved-Notch 1 (V1754) Antibody |
|||
A00033-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Cleaved-Notch 1 (V1754) Antibody (NOTCH1) detection.tested for WB in Human, Mouse, Rat. |
Anti-HDAC-1 (C-terminus) Antibody |
|||
A00256-1 | BosterBio | 100uL | EUR 531.6 |
Description: Rabbit Polyclonal HDAC-1 (C-terminus) Antibody. Validated in IF, IHC, WB and tested in Human. |
Anti-Sumo 1 Rabbit Monoclonal Antibody |
|||
M00631-1 | BosterBio | 100ug/vial | EUR 476.4 |
Description: Rabbit Monoclonal Sumo 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat. |
Anti-Cytokeratin 1 Rabbit Monoclonal Antibody |
|||
M01639-1 | BosterBio | 100ug/vial | EUR 476.4 |
Description: Rabbit Monoclonal Cytokeratin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat. |
Anti-Mitofusin 1 Antibody (monoclonal, 3H3) |
|||
M02172-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-Phospho-Beclin-1 (Ser295) Antibody |
|||
P00327-1 | BosterBio | 100ul | EUR 477.6 |
Description: Rabbit Polyclonal Phospho-Beclin-1 (Ser295) Antibody. Validated in WB and tested in Human. |
Anti-Phospho-Raf-1 (Ser642) Antibody |
|||
P00446-1 | BosterBio | 100ul | EUR 477.6 |
Description: Rabbit Polyclonal Phospho-Raf-1 (Ser642) Antibody. Validated in WB and tested in Human, Rat. |
Anti-Integrin alpha 1/ITGA1 Antibody |
|||
PA1045-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Caspase-1(P20)/CASP1 Antibody |
|||
PA1440-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-VEGF Receptor 1/FLT1 Antibody |
|||
PA1966-1 | BosterBio | 100ug/vial | EUR 352.8 |
Conclusions: Our results show that the ethics policy in DLT be sensitive to the limitations of treatment in terms of frequency and extension but did not have a significant impact on the time DLT. Since patients with hematological malignancies tend to undergo intensive therapy more frequently during their final days than patients with solid tumors, particular attention should be given to this group. To support the timely discussion, we suggest that the concept of advance care planning.