Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group

Background: The results of operations are not planned for bone sarcomas has not often discussed. However, it is important to recognize patterns, treatment, and clinical outcome of the operation was not planned for patients with bone sarcomas. The aim of this multicenter study to characterize the clinical outcome of patients with bone sarcoma who undergo planned operations.

Patients and methods: Data from 43 patients with bone sarcoma who undergo planned operations between 2006 and 2017 was obtained from 23 hospitals in Japan. These included 18 cases of osteosarcoma, Ewing sarcoma of 9, 8 of chondrosarcoma, and 6 undifferentiated pleomorphic sarcoma. The study involved 28 men and 15 women, with an average age of 46 years. The duration of the average follow-up was 59 months.

Results: The main primary tumor sites are the femur (n = 19), spine (n = 6), pelvis (n = 5), the tibia (n = 3), and humerus (n = 3). Diagnosis principal is benign bone tumors (n = 24), trauma (n = 7), bone metastases (n = 5), osteomyelitis (n = 4), degeneration (n = 2), and unknown (n = 1). As unplanned surgery, curettage, with or without bone graft, performed in 26 patients; Internal fixation is done at 7; spine surgery at 5; arthroplasty in 4; and arthroscopy in one.

Thirty-eight patients received standard treatments extra. Thirty-four patients underwent surgical resection of the tumor, including amputation (n = 10), and the remaining 4 receive radiotherapy or carbon ion radiotherapy for the treatment of additional standards. Level 5-year disease-specific survival (DSS) in patients with osteosarcoma, Ewing sarcoma, and chondrosarcoma was 65.5%, 58.3% and 72.9%, respectively. Twelve patients (27.9%) developed local recurrence (LR); among a total of 43 patients studied, the level of 5-year DSS was significantly worse for those who develop LR compared with those who did not (p = 0.03). 5-year DSS levels in patients with and without LR was 44% and 73.8%, respectively.

Conclusions: We recommend that patients undergoing surgery underwent unplanned given standard treatment, including the option to amputation because here, LR proved to be a risk factor for decreased DSS.

The Pathogenesis and Prevention Port-Site Metastasis in Gynecologic Oncology

Port-site metastases (PSM) is a specific and challenging complications of laparoscopic gynecologic oncology procedures. Research has shown that PSM is associated with morbidity and poor results. The exact pathogenesis of PSM in gynecological patients is not clear. Some precautions of PSM has been discussed in the relevant literature, and novel approaches to prevent this complication rarely keep up. In this review, we summarize the potential mechanisms of PSM and discuss the controversy and benefits of measures proposed prevention of PSM in gynecologic oncology.

We conducted a literature search using Medline database to identify studies of the pathogenesis and prevention of laparoscopic PSM. The hypothesis of the pathogenesis PSM at the center of the body’s immune response, pneumoperitoneum, contamination of wounds and surgical methods. convincing evidence of effective prevention of PSM after laparoscopic surgery is less. traditional preventive measures such as irrigation and tumor manipulation must be taken individually.

CO2 insufflation Hyperthermic and humidified CO2 leads to better outcomes in patients with malignant tumors who underwent laparoscopic procedures with the CO2 pneumoperitoneum than normal. Port-resection site showed no advantage in survival and outcome in the event of more injuries. PSM prevention plays an important part in the overall care of patients with gynecological malignancies who underwent laparoscopic procedures.

 Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group
Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group

End of the decision on the limitation of treatment in patients with cancer: an empirical analysis of the end-of-life practice of hematology and oncology unit at a university hospital in Germany

Background: The decision to limit treatment (DLTs) were essential to protect patients from overtreatment but it is one of the most ethically challenging situations in the practice of oncology. Ethics Policy Planning in Advance Care and Treatment study Limiting (EPAL), we examined how often DLT preceded the death of the patient and how early they were determined before (T1) and after (T2) the implementation of ethics policies intrainstitutional in DLT.

Methods: This prospective quantitative recruited 1,134 patients with hematology / oncology neoplasia within a period of 2 × 6 months at the Hospital of the University of Munich, Germany. Information on admission, discharge, diagnosis, age, DLT, date and place of death, and the time span between the initial determination of the DLT and the death of a patient are recorded using a standard form.

Results: Overall, 21% (n = 236) of the 1,134 patients, DLT was made. After the implementation of the policy, the proportion of reduction (26% T1 / T2 16%). However, the decision was more comprehensive, including more frequent combinations of ‘Do Not Resuscitate’ and ‘no intensive care unit’ (44% T1 / T2 64%). The median time between the determination of DLT and the patient’s death is equally short with 6 days in regular wards (each T1 / T2) and 10.5 / 9 (T1 / T2) days in the palliative care unit. For patients with solid tumors, DLTs made earlier in both routine and palliative care units than the deceased with hematologic neoplasia.

Mouse FLT-4/VEGFR-3 Control/blocking peptide #1

FLT41-P 100 ug
EUR 164

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT12-M 100 ug
EUR 482

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT14-M 100 ug
EUR 482

VEGFR-2, human recombinant protein

P1080-.1 100 µg
EUR 1929
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

Human FLT-4/VEGFR-3 control/blocking peptide #2

FLT42-P 100 ug
EUR 164

Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure

FLT15-A 100 ul
EUR 482

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 280

Rabbit Anti-Mouse FLT-4/VEGFR-3 IgG #1, aff pure

FLT41-A 100 ug
EUR 482

VEGFR Tyrosine Kinase Inhibitor II

C4603-1 1 mg
EUR 118

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518

Anti-Flt-1 antibody

STJ93093 200 µl
EUR 197
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody

STJ93094 200 µl
EUR 197
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody

STJ98080 100 µl
EUR 234
Description: Mouse monoclonal to Flt-1.

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 128
Description: HIV-1 Tat Protein Peptide

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein

PROTP01275-1 Regular: 50ug
EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0001 1.0mg
EUR 576
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0005 5.0mg
EUR 2207
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 235

Anti-PARP-1 Antibody

A00122-1 100ul
EUR 397
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse.

Anti-Presenilin 1 Antibody

A00138-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat.

Anti-CNG-1 Antibody

A05494-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for CNG-1 Antibody (CNGA1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Periphilin 1 Antibody

A06996-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse.

Anti-Lyl-1 Antibody

A07491-1 100ul
EUR 397
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat.

Anti-GLI-1 Antibody

A07972-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Cerebellin 1 Antibody

A09176-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-DOC-1 Antibody

A09467-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for DOC-1 Antibody (CDK2AP1) detection. Tested with WB in Human, Mouse.

Anti-PAI-1 Antibody

A00637-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat.

Anti-Flk-1 Antibody

A00901-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse.

Anti-EDG-1 Antibody

A01502-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat.

Anti-ROBO-1 Antibody

A01530-1 100ug
EUR 455
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-NPDC-1 Antibody

A12846-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for NPDC-1 Antibody (NPDC1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Bag-1 Antibody

A02423-1 50 ul
EUR 397
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat.

Anti-TUB 1 Antibody

A02917-1 100ug/vial
EUR 294

Anti-Dok-1 Antibody

A03039-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Dok-1 Antibody (DOK1) detection.tested for WB in Human, Mouse, Rat.

Anti-TFIIIB90-1 Antibody

A03761-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TFIIIB90-1 Antibody (BRF1) detection.tested for WB in Human, Mouse.

Anti-Atrophin-1 Antibody

A03828-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Atrophin-1 Antibody (ATN1) detection. Tested with WB in Human, Mouse, Rat.

Rabbit Anti-Human FLT-4/VEGFR-3 IgG #2, aff pure

FLT42-A 100 ug
EUR 482

C-type natriuretic peptide (1-22) (human, rat, swine)

B5441-1 1 mg
EUR 276

Anti-Apaf-1 (human) Monoclonal Antibody (2E12)

M00889-1 100ug
EUR 432
Description: Rat Monoclonal Apaf-1 (human) Antibody (2E12). Validated in ELISA, IP, IF, WB and tested in Human.

Anti-HO-1 Monoclonal Antibody (HO-1-2)

M00253-1 1mg
EUR 397
Description: Mouse Monoclonal HO-1 Antibody (HO-1-2). Validated in Flow Cytometry, IHC, WB and tested in Human, Mouse, Rat.

Lytic Peptide, Shiva ? 1

SP-88327-1 1 mg
EUR 347

Anti-Peptide YY/PYY Antibody

A04223-1 100ug/vial
EUR 334

Anti-Presenilin 1 Monoclonal Antibody

M00138-1 100ug
EUR 397
Description: Rabbit Monoclonal Presenilin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Galectin 1 Monoclonal Antibody

M00470-1 100ug
EUR 397
Description: Rabbit Monoclonal Galectin 1 Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat.

Anti-DJ-1 Monoclonal Antibody

M00757-1 100ul
EUR 397
Description: Mouse Monoclonal DJ-1 Antibody. Validated in IHC, WB and tested in Bovine, Human.

Anti-Enolase 1 Monoclonal Antibody

M01250-1 100ul
EUR 397
Description: Anti-Enolase 1 Monoclonal Antibody tested in WB, IF, ICC, IHC, reactive to Human, rat, mouse, cow, pig, horse

Anti-Dynamin 1 Monoclonal Antibody

M02536-1 100ug
EUR 397
Description: Rabbit Monoclonal Dynamin 1 Antibody. Validated in IF, WB and tested in Human, Mouse, Rat.

Anti-Esrp-1 Monoclonal Antibody

M06068-1 100uL
EUR 443
Description: Mouse Monoclonal Esrp-1 Antibody. Validated in WB and tested in Human.

Anti-Angiopoietin 1/ANGPT1 Antibody

PA1333-1 100ug/vial
EUR 334

Anti-Galectin 1/LGALS1 Antibody

PB9240-1 100ug/vial
EUR 334

Anti-TNF Receptor 1 Antibody

A00294-1 200ug
EUR 522
Description: Rabbit Polyclonal TNF Receptor 1 Antibody. Validated in IP, IHC, WB and tested in Human, Mouse, Rat.

Anti-CHST8/Galnac4St 1 Antibody

A10989-1 100ul
EUR 397
Description: Rabbit Polyclonal CHST8/Galnac4St 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Pyrophosphatase 1/PPA1 Antibody

A07485-1 100ug/vial
EUR 334

Anti-TCP-1 eta Antibody

A08169-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCP-1 eta Antibody (CCT7) detection. Tested with WB in Human, Mouse, Rat.

Anti-Relaxin 1/RLN1 Antibody

A08367-1 100ug/vial
EUR 334

Anti-TCP-1 zeta Antibody

A09373-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCP-1 zeta Antibody (CCT6A) detection.tested for WB in Human, Mouse, Rat.

Anti-Galectin 1/Lgals1 Antibody

A00470-1 100ug/vial
EUR 334

Anti-LOX-1/OLR1 Antibody

A00760-1 100ug/vial
EUR 294

Anti-Syndecan-1/SDC1 Antibody

A00991-1 100ug/vial
EUR 294

Anti-IRAK-1/IRAK1 Antibody

A01021-1 100ug/vial
EUR 334

Anti-Neurexin 1/NRXN1 Antibody

A01490-1 100ug/vial
EUR 334

Anti-Hexokinase 1/HK1 Antibody

A01504-1 100ug/vial
EUR 334

Anti-Synaptotagmin 1/SYT1 Antibody

A02314-1 100ug/vial
EUR 334

Anti-Syntenin-1 Monoclonal Antibody

A02475-1 100ul
EUR 397
Description: Mouse Monoclonal Antibody for Syntenin-1 Antibody (SDCBP) detection. Tested with WB in Human, Rat, Dog, Pig.

Anti-Dsg1/Desmoglein 1 Antibody

A02655-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Dsg1 Antibody (DSG1) detection.tested for IHC, WB in Human, Mouse, Rat.

Anti-CAF-1 p150 Antibody

A02732-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for CAF-1 p150 Antibody (CHAF1A) detection. Tested with WB in Human, Mouse.

Anti-Talin 1/TLN1 Antibody

A02859-1 100ug/vial
EUR 334

Anti-Islet 1/ISL1 Antibody

A02969-1 100ug/vial
EUR 334

Anti-Musashi 1/Msi1 Antibody

A05052-1 100ug/vial
EUR 334

VEGFR-1 Antibody

48347-100ul 100ul
EUR 333

VEGFR-1 Antibody

48347-50ul 50ul
EUR 239

Anti-P-glycoprotein (human) Monoclonal Antibody (JSB-1)

M00049-1 125ug
EUR 586
Description: Mouse Monoclonal P-glycoprotein (human) Antibody (JSB-1). Validated in IF and tested in Human.

Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378

M04431-1 100uL
EUR 385
Description: Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 tested in WB, IHC, reactive to Human

AXMIR-1 RNA oligo anti-miRNA-1-3p with Xmotif

AXMIR-1 10 reactions
EUR 438

Human/Rat/Mouse PLP104-117 peptide, depalmitoylated

PLP104-1-1 1 mg
EUR 141

Human/Rat/Mouse PLP178-191 peptide, depalmitoylated

PLP178-1-1 1 mg
EUR 141

Human/Rat/Mouse PLP40-59 peptide, depalmitoylated

PLP40-1-1 1 mg
EUR 141

Anti-Sumo 1 Rabbit Monoclonal Antibody

M00631-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Sumo 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Cytokeratin 1 Rabbit Monoclonal Antibody

M01639-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Cytokeratin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Mitofusin 1 Antibody (monoclonal, 3H3)

M02172-1 100ug/vial
EUR 294

Anti-Phospho-Beclin-1 (Ser295) Antibody

P00327-1 100ul
EUR 398
Description: Rabbit Polyclonal Phospho-Beclin-1 (Ser295) Antibody. Validated in WB and tested in Human.

Anti-Phospho-Raf-1 (Ser642) Antibody

P00446-1 100ul
EUR 398
Description: Rabbit Polyclonal Phospho-Raf-1 (Ser642) Antibody. Validated in WB and tested in Human, Rat.

Anti-Integrin alpha 1/ITGA1 Antibody

PA1045-1 100ug/vial
EUR 334

Anti-Caspase-1(P20)/CASP1 Antibody

PA1440-1 100ug/vial
EUR 294

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-1 100ug/vial
EUR 294

Anti-HIF-1 alpha/HIF1A Antibody

A00013-1 100ug/vial
EUR 294

Anti-Cleaved-Notch 1 (V1754) Antibody

A00033-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Cleaved-Notch 1 (V1754) Antibody (NOTCH1) detection.tested for WB in Human, Mouse, Rat.

Anti-HDAC-1 (C-terminus) Antibody

A00256-1 100uL
EUR 443
Description: Rabbit Polyclonal HDAC-1 (C-terminus) Antibody. Validated in IF, IHC, WB and tested in Human.

Anti-CELSR3/Flamingo Homolog 1 Antibody

A07204-1 100ul
EUR 397
Description: Rabbit Polyclonal CELSR3/Flamingo Homolog 1 Antibody. Validated in IF and tested in Human, Mouse, Rat.

Anti-LPCAT2/Acyltransferase Like 1 Antibody

A07471-1 100ul
EUR 397
Description: Rabbit Polyclonal LPCAT2/Acyltransferase Like 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-VEGF Receptor 1/FLT1 Antibody

A00534-1 100ug/vial
EUR 294

Conclusions: Our results show that the ethics policy in DLT be sensitive to the limitations of treatment in terms of frequency and extension but did not have a significant impact on the time DLT. Since patients with hematological malignancies tend to undergo intensive therapy more frequently during their final days than patients with solid tumors, particular attention should be given to this group. To support the timely discussion, we suggest that the concept of advance care planning.

Related Posts

Leave a Reply

Your email address will not be published.