Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group

Background: The results of operations are not planned for bone sarcomas has not often discussed. However, it is important to recognize patterns, treatment, and clinical outcome of the operation was not planned for patients with bone sarcomas. The aim of this multicenter study to characterize the clinical outcome of patients with bone sarcoma who undergo planned operations.

Patients and methods: Data from 43 patients with bone sarcoma who undergo planned operations between 2006 and 2017 was obtained from 23 hospitals in Japan. These included 18 cases of osteosarcoma, Ewing sarcoma of 9, 8 of chondrosarcoma, and 6 undifferentiated pleomorphic sarcoma. The study involved 28 men and 15 women, with an average age of 46 years. The duration of the average follow-up was 59 months.

Results: The main primary tumor sites are the femur (n = 19), spine (n = 6), pelvis (n = 5), the tibia (n = 3), and humerus (n = 3). Diagnosis principal is benign bone tumors (n = 24), trauma (n = 7), bone metastases (n = 5), osteomyelitis (n = 4), degeneration (n = 2), and unknown (n = 1). As unplanned surgery, curettage, with or without bone graft, performed in 26 patients; Internal fixation is done at 7; spine surgery at 5; arthroplasty in 4; and arthroscopy in one.

Thirty-eight patients received standard treatments extra. Thirty-four patients underwent surgical resection of the tumor, including amputation (n = 10), and the remaining 4 receive radiotherapy or carbon ion radiotherapy for the treatment of additional standards. Level 5-year disease-specific survival (DSS) in patients with osteosarcoma, Ewing sarcoma, and chondrosarcoma was 65.5%, 58.3% and 72.9%, respectively. Twelve patients (27.9%) developed local recurrence (LR); among a total of 43 patients studied, the level of 5-year DSS was significantly worse for those who develop LR compared with those who did not (p = 0.03). 5-year DSS levels in patients with and without LR was 44% and 73.8%, respectively.

Conclusions: We recommend that patients undergoing surgery underwent unplanned given standard treatment, including the option to amputation because here, LR proved to be a risk factor for decreased DSS.

The Pathogenesis and Prevention Port-Site Metastasis in Gynecologic Oncology

Port-site metastases (PSM) is a specific and challenging complications of laparoscopic gynecologic oncology procedures. Research has shown that PSM is associated with morbidity and poor results. The exact pathogenesis of PSM in gynecological patients is not clear. Some precautions of PSM has been discussed in the relevant literature, and novel approaches to prevent this complication rarely keep up. In this review, we summarize the potential mechanisms of PSM and discuss the controversy and benefits of measures proposed prevention of PSM in gynecologic oncology.

We conducted a literature search using Medline database to identify studies of the pathogenesis and prevention of laparoscopic PSM. The hypothesis of the pathogenesis PSM at the center of the body’s immune response, pneumoperitoneum, contamination of wounds and surgical methods. convincing evidence of effective prevention of PSM after laparoscopic surgery is less. traditional preventive measures such as irrigation and tumor manipulation must be taken individually.

CO2 insufflation Hyperthermic and humidified CO2 leads to better outcomes in patients with malignant tumors who underwent laparoscopic procedures with the CO2 pneumoperitoneum than normal. Port-resection site showed no advantage in survival and outcome in the event of more injuries. PSM prevention plays an important part in the overall care of patients with gynecological malignancies who underwent laparoscopic procedures.

 Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group
Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group

End of the decision on the limitation of treatment in patients with cancer: an empirical analysis of the end-of-life practice of hematology and oncology unit at a university hospital in Germany

Background: The decision to limit treatment (DLTs) were essential to protect patients from overtreatment but it is one of the most ethically challenging situations in the practice of oncology. Ethics Policy Planning in Advance Care and Treatment study Limiting (EPAL), we examined how often DLT preceded the death of the patient and how early they were determined before (T1) and after (T2) the implementation of ethics policies intrainstitutional in DLT.

Methods: This prospective quantitative recruited 1,134 patients with hematology / oncology neoplasia within a period of 2 × 6 months at the Hospital of the University of Munich, Germany. Information on admission, discharge, diagnosis, age, DLT, date and place of death, and the time span between the initial determination of the DLT and the death of a patient are recorded using a standard form.

Results: Overall, 21% (n = 236) of the 1,134 patients, DLT was made. After the implementation of the policy, the proportion of reduction (26% T1 / T2 16%). However, the decision was more comprehensive, including more frequent combinations of ‘Do Not Resuscitate’ and ‘no intensive care unit’ (44% T1 / T2 64%). The median time between the determination of DLT and the patient’s death is equally short with 6 days in regular wards (each T1 / T2) and 10.5 / 9 (T1 / T2) days in the palliative care unit. For patients with solid tumors, DLTs made earlier in both routine and palliative care units than the deceased with hematologic neoplasia.

Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated

A12001
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Goat Anti-Rat Secondary Antibody, Biotin Conjugated

A12002
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Human Genomic DNA 

X11000
  • Ask for price
  • EUR 235.40
  • 0.2 ml
  • 0.2 ml

Human Brain Genomic DNA  

X11001
  • Ask for price
  • EUR 77.00
  • 10 µg
  • 10 ul

Anti-Flt-4 Antibody

A01276-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Flt-4 Antibody (FLT4) detection.tested for IHC, WB in Human, Mouse, Rat.

Mouse FLT-4/VEGFR-3 Control/blocking peptide #1

FLT41-P 100 ug
EUR 196.8

Rabbit Anti-human FLT-1/VEGFR-1 IgG #1, aff pure

FLT11-A 100 ul
EUR 578.4

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT12-M 100 ug
EUR 578.4

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT14-M 100 ug
EUR 578.4

Histone H3 Methylation Antibody Panel Pack I – Active Genes

C10000
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack I – Repression Genes

C10001
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack II – Active Genes

C10002
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3 Methylation Antibody Panel Pack II – Repression Genes

C10003
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack III – Active Genes

C10004
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3K4 Methylation Antibody Panel Pack

C10005
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K9 Methylation Antibody Panel Pack

C10006
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K27 Methylation Antibody Panel Pack

C10007
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K36 Methylation Antibody Panel Pack

C10008
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K79 Methylation Antibody Panel Pack

C10009
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3 Acetylation Antibody Panel Pack I

C10010
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Acetylation Antibody Panel Pack II

C10011
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H4K20 Methylation Antibody Panel Pack

C10012
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4 Acetylation Antibody Panel Pack

C10013
  • EUR 754.26
  • EUR 470.80
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Phosphorylation Antibody Panel Pack

C10014
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R2 Methylation Antibody Panel Pack

C10015
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R8 Methylation Antibody Panel Pack

C10016
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R17 Methylation Antibody Panel Pack

C10017
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R26 Methylation Antibody Panel Pack

C10018
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4R3 Methylation Antibody Panel Pack

C10019
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

DNMT3A Protein

E11000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

TET1 Protein (Active)

E12002
  • EUR 387.12
  • EUR 225.50
  • 10 µg
  • 10 ul

DNMT3B Protein 

E14000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

DNMT1 Protein 

E15000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

HDAC1 Protein 

E24002
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC10 Protein 

E24003
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC11 Protein 

E24004
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC2 Protein 

E24005
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC3 Protein 

E24006
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC4 Protein 

E24007
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC5 Protein 

E24008
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC6 Protein 

E24009
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC7 Protein 

E24010
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC8 Protein 

E24011
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC9 Protein 

E24012
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

H3F3A Protein 

E35003
  • EUR 174.84
  • EUR 78.10
  • 50 µg
  • 50 ul

H4 Protein 

E35005
  • EUR 174.84
  • EUR 78.10
  • 50 µg
  • 50 ul

SOD1 Protein 

E70000
  • EUR 599.40
  • EUR 365.20
  • 25 µg
  • 25 ul

EpiMag HT (96-Well) Magnetic Separator

Q10002
  • EUR 416.70
  • EUR 258.50
  • 1/Pack
  • 1/Pack

EpiMag 96-Well Microplate (5/pack) 

Q10003
  • EUR 136.56
  • EUR 52.80
  • 5/pack
  • 5/pack

DNA Methylation Antibody Panel Pack I

C20000
  • EUR 458.46
  • EUR 270.60
  • each
  • 2 x 25 ul

SARS-CoV-2 Spike S1 RBD Protein, Human Fc-Fusion, Avi-Tag

E80025
  • EUR 635.80
  • EUR 3934.70
  • 100 ul
  • 1 ml

VEGFR-2, human recombinant protein

P1080-.1 100 µg
EUR 2314.8
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

Human FLT-4/VEGFR-3 control/blocking peptide #2

FLT42-P 100 ug
EUR 196.8

ACE2, His-Tag Protein

E80019
  • EUR 612.70
  • EUR 1437.70
  • 20 ul
  • 100 ul

SARS-CoV-2 Spike S1 (13-665) Protein, Fc Fusion, Avi-tag

E80020
  • EUR 635.80
  • EUR 4276.80
  • 100 ul
  • 1 ml

SARS-CoV-2 Spike S1 (16-685) Protein, Avi-His-tag

E80021
  • EUR 635.80
  • EUR 4276.80
  • 100 ul
  • 1 ml

SARS-CoV-2 Spike S1 (16-685) Protein, Fc Fusion, Avi-tag

E80022
  • EUR 635.80
  • EUR 4276.80
  • 100 ul
  • 1 ml

SARS-CoV-2 Spike S1 RBD (V367F) Protein, Avi-His-tag

E80023
  • EUR 635.80
  • EUR 3934.70
  • 100 ul
  • 1 ml

SARS-CoV-2 Spike S1 RBD Protein, Avi-His-tag

E80024
  • EUR 635.80
  • EUR 4995.10
  • 100 ul
  • 1 ml

SARS-CoV-2 Spike S1 RBD Protein, Mouse Fc-fusion

E80026
  • EUR 588.50
  • EUR 823.90
  • 20 ul
  • 50 ul

SARS-CoV-2 Nucleocapsid Protein, Avi-His-tag

E80027
  • EUR 635.80
  • EUR 4087.60
  • 1 ml
  • 100 ul

Recombinant SARS-CoV-2 Spike Glycoprotein(S) (D614G), Partial

E80028
  • EUR 388.30
  • EUR 860.20
  • 20 ul
  • 100 ul

Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure

FLT15-A 100 ul
EUR 578.4

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 331.2

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 336

VEGFR Tyrosine Kinase Inhibitor II

C4603-1 1 mg
EUR 141.6

Rabbit Anti-Mouse FLT-4/VEGFR-3 IgG #1, aff pure

FLT41-A 100 ug
EUR 578.4

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 621.6

Methylamp 96 DNA Modification Kit 

P-1008
  • EUR 416.70
  • EUR 253.00
  • 96 Samples
  • 96 Samples

EpiQuik Nuclear Extraction Kit 

OP-0002
  • EUR 350.58
  • EUR 211.20
  • 100 Assays
  • 100 Extractions

Nucleic Acid Isolation Enhancer (Glycogen Solution) 

R-1001
  • EUR 164.40
  • EUR 75.90
  • 500 µl
  • 500 ul

Methylamp PCR Enhancer 

R-1002
  • EUR 185.28
  • EUR 90.20
  • 400 Reactions
  • 400 Reactions

Streptavidin: HRP Conjugate

R-1098
  • EUR 218.34
  • EUR 107.80
  • 0.5 ml
  • 0.5 ml

Streptavidin 

R-1100
  • EUR 237.48
  • EUR 121.00
  • 1 mg
  • 1 ml

Protease Inhibitor Cocktail 

R-1101
  • EUR 176.58
  • EUR 79.20
  • 1 ml
  • 1 ml

Streptavidin-Coated Strip Microwell Plate (Flat) 

R-1102
  • EUR 361.02
  • EUR 204.60
  • 5/pk
  • 5/pk

DNA High Binding Solution

R-1103
  • EUR 267.06
  • EUR 140.80
  • 30 ml
  • 30 ml

DTT Solution 

R-1104
  • EUR 131.34
  • EUR 48.40
  • 1 ml, 500 mM
  • 1 ml, 500 mM

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 108
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 153.6
Description: HIV-1 Tat Protein Peptide

Anti-Flt-1 antibody

STJ93093 200 µl
EUR 236.4
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody

STJ93094 200 µl
EUR 236.4
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody

STJ98080 100 µl
EUR 280.8
Description: Mouse monoclonal to Flt-1.

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein

PROTP01275-1 Regular: 50ug
EUR 380.4
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0001 1.0mg
EUR 691.2
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0005 5.0mg
EUR 2648.4
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

Recombinant Transmembrane Protease Serine 2 Protein, Partial

E80016
  • EUR 470.80
  • EUR 753.50
  • EUR 1824.90
  • 20 ul
  • 100 ul
  • 500 ul

Recombinant TMPRSS2 Protein, Partial

E80017
  • EUR 423.50
  • EUR 660.00
  • EUR 2321.00
  • 20 ul
  • 100 ul
  • 1 ml

Recombinant Novel Coronavirus Spike Glycoprotein(S), Partial

E80018
  • EUR 388.30
  • EUR 860.20
  • EUR 4888.40
  • 20 ul
  • 100 ul
  • 1 ml

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 282

C-type natriuretic peptide (1-22) (human, rat, swine)

B5441-1 1 mg
EUR 331.2

Anti-human PD-1, PE-labeled

71290-1 50 µg
EUR 355
Description: R-Phycoerythrin-labeled anti-PD-1 neutralizing recombinant murine/human chimeric antibody recognizing the PD-L1/PD-L2 binding region of human PD-1. This antibody does not cross-react with mouse PD-1, but does cross-react with monkey (M. fascicularis) PD-1. It has not been tested with other species.

Rabbit Anti-Human FLT-4/VEGFR-3 IgG #2, aff pure

FLT42-A 100 ug
EUR 578.4

Histone H4 peptide (1-21), Biotin-labeled

52018-1 2.5 nmole
EUR 90
Description: Histone H4 peptide, amino acids 1 to 21, acetylated at the N-terminus and biotinylated on the side chain of Lys. A GG spacer has been added on the C-terminus of Lys.

Lytic Peptide, Shiva ? 1

SP-88327-1 1 mg
EUR 416.4

Anti-EDG-1 Antibody

A01502-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat.

Anti-ROBO-1 Antibody

A01530-1 100ug
EUR 546
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Bag-1 Antibody

A02423-1 50 ul
EUR 476.4
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat.

Anti-TUB 1 Antibody

A02917-1 100ug/vial
EUR 352.8

Anti-Dok-1 Antibody

A03039-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Dok-1 Antibody (DOK1) detection.tested for WB in Human, Mouse, Rat.

Anti-TFIIIB90-1 Antibody

A03761-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for TFIIIB90-1 Antibody (BRF1) detection.tested for WB in Human, Mouse.

Anti-Atrophin-1 Antibody

A03828-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Atrophin-1 Antibody (ATN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-CNG-1 Antibody

A05494-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for CNG-1 Antibody (CNGA1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Periphilin 1 Antibody

A06996-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse.

Anti-Lyl-1 Antibody

A07491-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat.

Anti-GLI-1 Antibody

A07972-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Cerebellin 1 Antibody

A09176-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-DOC-1 Antibody

A09467-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for DOC-1 Antibody (CDK2AP1) detection. Tested with WB in Human, Mouse.

Anti-NPDC-1 Antibody

A12846-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for NPDC-1 Antibody (NPDC1) detection. Tested with WB in Human, Mouse, Rat.

Anti-PAI-1 Antibody

A00637-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat.

Anti-Flk-1 Antibody

A00901-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse.

Anti-PARP-1 Antibody

A00122-1 100ul
EUR 476.4
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse.

Anti-Presenilin 1 Antibody

A00138-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat.

Anti-Apaf-1 (human) Monoclonal Antibody (2E12)

M00889-1 100ug
EUR 518.4
Description: Rat Monoclonal Apaf-1 (human) Antibody (2E12). Validated in ELISA, IP, IF, WB and tested in Human.

Anti-Peptide YY/PYY Antibody

A04223-1 100ug/vial
EUR 400.8

VEGFR-1 Antibody

48347-100ul 100ul
EUR 399.6

VEGFR-1 Antibody

48347-50ul 50ul
EUR 286.8

Anti-HO-1 Monoclonal Antibody (HO-1-2)

M00253-1 1mg
EUR 476.4
Description: Mouse Monoclonal HO-1 Antibody (HO-1-2). Validated in Flow Cytometry, IHC, WB and tested in Human, Mouse, Rat.

Human/Rat/Mouse PLP104-117 peptide, depalmitoylated

PLP104-1-1 1 mg
EUR 169.2

Human/Rat/Mouse PLP178-191 peptide, depalmitoylated

PLP178-1-1 1 mg
EUR 169.2

Human/Rat/Mouse PLP40-59 peptide, depalmitoylated

PLP40-1-1 1 mg
EUR 169.2

Anti-Neurexin 1/NRXN1 Antibody

A01490-1 100ug/vial
EUR 400.8

Anti-Hexokinase 1/HK1 Antibody

A01504-1 100ug/vial
EUR 400.8

Anti-Synaptotagmin 1/SYT1 Antibody

A02314-1 100ug/vial
EUR 400.8

Anti-Syntenin-1 Monoclonal Antibody

A02475-1 100ul
EUR 476.4
Description: Mouse Monoclonal Antibody for Syntenin-1 Antibody (SDCBP) detection. Tested with WB in Human, Rat, Dog, Pig.

Anti-Dsg1/Desmoglein 1 Antibody

A02655-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Dsg1 Antibody (DSG1) detection.tested for IHC, WB in Human, Mouse, Rat.

Anti-CAF-1 p150 Antibody

A02732-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for CAF-1 p150 Antibody (CHAF1A) detection. Tested with WB in Human, Mouse.

Anti-Talin 1/TLN1 Antibody

A02859-1 100ug/vial
EUR 400.8

Anti-Islet 1/ISL1 Antibody

A02969-1 100ug/vial
EUR 400.8

Anti-Musashi 1/Msi1 Antibody

A05052-1 100ug/vial
EUR 400.8

Anti-Pyrophosphatase 1/PPA1 Antibody

A07485-1 100ug/vial
EUR 400.8

Anti-TCP-1 eta Antibody

A08169-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for TCP-1 eta Antibody (CCT7) detection. Tested with WB in Human, Mouse, Rat.

Anti-Relaxin 1/RLN1 Antibody

A08367-1 100ug/vial
EUR 400.8

Anti-TCP-1 zeta Antibody

A09373-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for TCP-1 zeta Antibody (CCT6A) detection.tested for WB in Human, Mouse, Rat.

Anti-Galectin 1/Lgals1 Antibody

A00470-1 100ug/vial
EUR 400.8

Anti-LOX-1/OLR1 Antibody

A00760-1 100ug/vial
EUR 352.8

Anti-Syndecan-1/SDC1 Antibody

A00991-1 100ug/vial
EUR 352.8

Anti-IRAK-1/IRAK1 Antibody

A01021-1 100ug/vial
EUR 400.8

Anti-CHST8/Galnac4St 1 Antibody

A10989-1 100ul
EUR 476.4
Description: Rabbit Polyclonal CHST8/Galnac4St 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-TNF Receptor 1 Antibody

A00294-1 200ug
EUR 626.4
Description: Rabbit Polyclonal TNF Receptor 1 Antibody. Validated in IP, IHC, WB and tested in Human, Mouse, Rat.

Anti-Galectin 1 Monoclonal Antibody

M00470-1 100ug
EUR 476.4
Description: Rabbit Monoclonal Galectin 1 Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat.

Anti-DJ-1 Monoclonal Antibody

M00757-1 100ul
EUR 476.4
Description: Mouse Monoclonal DJ-1 Antibody. Validated in IHC, WB and tested in Bovine, Human.

Anti-Enolase 1 Monoclonal Antibody

M01250-1 100ul
EUR 476.4
Description: Anti-Enolase 1 Monoclonal Antibody tested in WB, IF, ICC, IHC, reactive to Human, rat, mouse, cow, pig, horse

Anti-Dynamin 1 Monoclonal Antibody

M02536-1 100ug
EUR 476.4
Description: Rabbit Monoclonal Dynamin 1 Antibody. Validated in IF, WB and tested in Human, Mouse, Rat.

Anti-Esrp-1 Monoclonal Antibody

M06068-1 100uL
EUR 531.6
Description: Mouse Monoclonal Esrp-1 Antibody. Validated in WB and tested in Human.

Anti-Presenilin 1 Monoclonal Antibody

M00138-1 100ug
EUR 476.4
Description: Rabbit Monoclonal Presenilin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Angiopoietin 1/ANGPT1 Antibody

PA1333-1 100ug/vial
EUR 400.8

Anti-Galectin 1/LGALS1 Antibody

PB9240-1 100ug/vial
EUR 400.8

Anti-PD-1 Agonistic Antibody

101178-1 50 µg
EUR 335
Description: Anti-PD-1 IgG antibody is a purified recombinant antibody which recognizes human PD1 antigen. This antibody has been functionally tested in two co-culture assays.

Anti-P-glycoprotein (human) Monoclonal Antibody (JSB-1)

M00049-1 125ug
EUR 703.2
Description: Mouse Monoclonal P-glycoprotein (human) Antibody (JSB-1). Validated in IF and tested in Human.

Mouse FLK-1/VEGFR-2 control/blocking peptide # 1

FLK11-P 100 ug
EUR 196.8

Human/Rat/Mouse PLP139-151 (S140) peptide, depalmitoylated

PLP139-1-1 1 mg
EUR 169.2

VEGFR-1/Flt1/ Rat VEGFR- 1/ Flt1 ELISA Kit

ELA-E0147r 96 Tests
EUR 1063.2

Human Vascuar endothelial cell growth factor receptor 3, VEGFR-3/Flt-4 ELISA Kit

1-CSB-E04765h
  • EUR 843.60
  • EUR 5811.60
  • EUR 3084.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitative sandwich ELISA kit for measuring Human Vascuar endothelial cell growth factor receptor 3, VEGFR-3/Flt-4 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Endothelin-1 (1-15), amide, human

A1111-1 1 mg
EUR 866.4
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Haptoglobin, (Phenotype 1-1) Human Plasma

7536-1 each
EUR 385.2

AXMIR-1 RNA oligo anti-miRNA-1-3p with Xmotif

AXMIR-1 10 reactions
EUR 525.6

Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378

M04431-1 100uL
EUR 462
Description: Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 tested in WB, IHC, reactive to Human

Anti-HLA-G (human) Monoclonal Antibody (MEM-G/1)

M01235-1 100ug
EUR 476.4
Description: Mouse Monoclonal HLA-G (human) Antibody (MEM-G/1). Validated in IHC, WB and tested in Human.

Anti-Liver Carboxylesterase 1/CES1 Antibody

A01741-1 100ug/vial
EUR 400.8

Anti-EBP50/NHERF-1/SLC9A3R1 Antibody

A02427-1 100ug/vial
EUR 400.8

Anti-IL1R2/Il 1 Rii Antibody

A03106-1 1 ml
EUR 476.4
Description: Rabbit Polyclonal IL1R2/Il 1 Rii Antibody. Validated in IP, WB and tested in Human.

Anti-Hyaluronan synthase 1/HAS1 Antibody

A04784-1 100ug/vial
EUR 400.8

Anti-CELSR3/Flamingo Homolog 1 Antibody

A07204-1 100ul
EUR 476.4
Description: Rabbit Polyclonal CELSR3/Flamingo Homolog 1 Antibody. Validated in IF and tested in Human, Mouse, Rat.

Anti-LPCAT2/Acyltransferase Like 1 Antibody

A07471-1 100ul
EUR 476.4
Description: Rabbit Polyclonal LPCAT2/Acyltransferase Like 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-VEGF Receptor 1/FLT1 Antibody

A00534-1 100ug/vial
EUR 352.8

Anti-HIF-1 alpha/HIF1A Antibody

A00013-1 100ug/vial
EUR 352.8

Anti-Cleaved-Notch 1 (V1754) Antibody

A00033-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Cleaved-Notch 1 (V1754) Antibody (NOTCH1) detection.tested for WB in Human, Mouse, Rat.

Anti-HDAC-1 (C-terminus) Antibody

A00256-1 100uL
EUR 531.6
Description: Rabbit Polyclonal HDAC-1 (C-terminus) Antibody. Validated in IF, IHC, WB and tested in Human.

Anti-Sumo 1 Rabbit Monoclonal Antibody

M00631-1 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Sumo 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Cytokeratin 1 Rabbit Monoclonal Antibody

M01639-1 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Cytokeratin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Mitofusin 1 Antibody (monoclonal, 3H3)

M02172-1 100ug/vial
EUR 352.8

Anti-Phospho-Beclin-1 (Ser295) Antibody

P00327-1 100ul
EUR 477.6
Description: Rabbit Polyclonal Phospho-Beclin-1 (Ser295) Antibody. Validated in WB and tested in Human.

Anti-Phospho-Raf-1 (Ser642) Antibody

P00446-1 100ul
EUR 477.6
Description: Rabbit Polyclonal Phospho-Raf-1 (Ser642) Antibody. Validated in WB and tested in Human, Rat.

Anti-Integrin alpha 1/ITGA1 Antibody

PA1045-1 100ug/vial
EUR 400.8

Anti-Caspase-1(P20)/CASP1 Antibody

PA1440-1 100ug/vial
EUR 352.8

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-1 100ug/vial
EUR 352.8

Conclusions: Our results show that the ethics policy in DLT be sensitive to the limitations of treatment in terms of frequency and extension but did not have a significant impact on the time DLT. Since patients with hematological malignancies tend to undergo intensive therapy more frequently during their final days than patients with solid tumors, particular attention should be given to this group. To support the timely discussion, we suggest that the concept of advance care planning.

Related Posts

Leave a Reply

Your email address will not be published.