Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group
Background: The results of operations are not planned for bone sarcomas has not often discussed. However, it is important to recognize patterns, treatment, and clinical outcome of the operation was not planned for patients with bone sarcomas. The aim of this multicenter study to characterize the clinical outcome of patients with bone sarcoma who undergo planned operations.
Patients and methods: Data from 43 patients with bone sarcoma who undergo planned operations between 2006 and 2017 was obtained from 23 hospitals in Japan. These included 18 cases of osteosarcoma, Ewing sarcoma of 9, 8 of chondrosarcoma, and 6 undifferentiated pleomorphic sarcoma. The study involved 28 men and 15 women, with an average age of 46 years. The duration of the average follow-up was 59 months.
Results: The main primary tumor sites are the femur (n = 19), spine (n = 6), pelvis (n = 5), the tibia (n = 3), and humerus (n = 3). Diagnosis principal is benign bone tumors (n = 24), trauma (n = 7), bone metastases (n = 5), osteomyelitis (n = 4), degeneration (n = 2), and unknown (n = 1). As unplanned surgery, curettage, with or without bone graft, performed in 26 patients; Internal fixation is done at 7; spine surgery at 5; arthroplasty in 4; and arthroscopy in one.
Thirty-eight patients received standard treatments extra. Thirty-four patients underwent surgical resection of the tumor, including amputation (n = 10), and the remaining 4 receive radiotherapy or carbon ion radiotherapy for the treatment of additional standards. Level 5-year disease-specific survival (DSS) in patients with osteosarcoma, Ewing sarcoma, and chondrosarcoma was 65.5%, 58.3% and 72.9%, respectively. Twelve patients (27.9%) developed local recurrence (LR); among a total of 43 patients studied, the level of 5-year DSS was significantly worse for those who develop LR compared with those who did not (p = 0.03). 5-year DSS levels in patients with and without LR was 44% and 73.8%, respectively.
Conclusions: We recommend that patients undergoing surgery underwent unplanned given standard treatment, including the option to amputation because here, LR proved to be a risk factor for decreased DSS.
The Pathogenesis and Prevention Port-Site Metastasis in Gynecologic Oncology
Port-site metastases (PSM) is a specific and challenging complications of laparoscopic gynecologic oncology procedures. Research has shown that PSM is associated with morbidity and poor results. The exact pathogenesis of PSM in gynecological patients is not clear. Some precautions of PSM has been discussed in the relevant literature, and novel approaches to prevent this complication rarely keep up. In this review, we summarize the potential mechanisms of PSM and discuss the controversy and benefits of measures proposed prevention of PSM in gynecologic oncology.
We conducted a literature search using Medline database to identify studies of the pathogenesis and prevention of laparoscopic PSM. The hypothesis of the pathogenesis PSM at the center of the body’s immune response, pneumoperitoneum, contamination of wounds and surgical methods. convincing evidence of effective prevention of PSM after laparoscopic surgery is less. traditional preventive measures such as irrigation and tumor manipulation must be taken individually.
CO2 insufflation Hyperthermic and humidified CO2 leads to better outcomes in patients with malignant tumors who underwent laparoscopic procedures with the CO2 pneumoperitoneum than normal. Port-resection site showed no advantage in survival and outcome in the event of more injuries. PSM prevention plays an important part in the overall care of patients with gynecological malignancies who underwent laparoscopic procedures.
Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group
End of the decision on the limitation of treatment in patients with cancer: an empirical analysis of the end-of-life practice of hematology and oncology unit at a university hospital in Germany
Background: The decision to limit treatment (DLTs) were essential to protect patients from overtreatment but it is one of the most ethically challenging situations in the practice of oncology. Ethics Policy Planning in Advance Care and Treatment study Limiting (EPAL), we examined how often DLT preceded the death of the patient and how early they were determined before (T1) and after (T2) the implementation of ethics policies intrainstitutional in DLT.
Methods: This prospective quantitative recruited 1,134 patients with hematology / oncology neoplasia within a period of 2 × 6 months at the Hospital of the University of Munich, Germany. Information on admission, discharge, diagnosis, age, DLT, date and place of death, and the time span between the initial determination of the DLT and the death of a patient are recorded using a standard form.
Results: Overall, 21% (n = 236) of the 1,134 patients, DLT was made. After the implementation of the policy, the proportion of reduction (26% T1 / T2 16%). However, the decision was more comprehensive, including more frequent combinations of ‘Do Not Resuscitate’ and ‘no intensive care unit’ (44% T1 / T2 64%). The median time between the determination of DLT and the patient’s death is equally short with 6 days in regular wards (each T1 / T2) and 10.5 / 9 (T1 / T2) days in the palliative care unit. For patients with solid tumors, DLTs made earlier in both routine and palliative care units than the deceased with hematologic neoplasia.
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.
(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1333
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1333
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1333
Description: The amyloid ?-peptide (A?) has a central role in initiating neurodegeneration in Alzheimer disease (AD) 1. It is widely believed to be an incidental catabolic byproduct of the amyloid ? protein precursor (APP) with no normal physiological function.
PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle. Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7. It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3 kDa protein containing 160 amino acid residues.
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
TGF-b-1 Transforming Growth Factor-beta 1 Human protein
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.
MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.
Description: Minimum order quantity: 1 unit of 50uL
Conclusions: Our results show that the ethics policy in DLT be sensitive to the limitations of treatment in terms of frequency and extension but did not have a significant impact on the time DLT. Since patients with hematological malignancies tend to undergo intensive therapy more frequently during their final days than patients with solid tumors, particular attention should be given to this group. To support the timely discussion, we suggest that the concept of advance care planning.