Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group

Background: The results of operations are not planned for bone sarcomas has not often discussed. However, it is important to recognize patterns, treatment, and clinical outcome of the operation was not planned for patients with bone sarcomas. The aim of this multicenter study to characterize the clinical outcome of patients with bone sarcoma who undergo planned operations.

Patients and methods: Data from 43 patients with bone sarcoma who undergo planned operations between 2006 and 2017 was obtained from 23 hospitals in Japan. These included 18 cases of osteosarcoma, Ewing sarcoma of 9, 8 of chondrosarcoma, and 6 undifferentiated pleomorphic sarcoma. The study involved 28 men and 15 women, with an average age of 46 years. The duration of the average follow-up was 59 months.

Results: The main primary tumor sites are the femur (n = 19), spine (n = 6), pelvis (n = 5), the tibia (n = 3), and humerus (n = 3). Diagnosis principal is benign bone tumors (n = 24), trauma (n = 7), bone metastases (n = 5), osteomyelitis (n = 4), degeneration (n = 2), and unknown (n = 1). As unplanned surgery, curettage, with or without bone graft, performed in 26 patients; Internal fixation is done at 7; spine surgery at 5; arthroplasty in 4; and arthroscopy in one.

Thirty-eight patients received standard treatments extra. Thirty-four patients underwent surgical resection of the tumor, including amputation (n = 10), and the remaining 4 receive radiotherapy or carbon ion radiotherapy for the treatment of additional standards. Level 5-year disease-specific survival (DSS) in patients with osteosarcoma, Ewing sarcoma, and chondrosarcoma was 65.5%, 58.3% and 72.9%, respectively. Twelve patients (27.9%) developed local recurrence (LR); among a total of 43 patients studied, the level of 5-year DSS was significantly worse for those who develop LR compared with those who did not (p = 0.03). 5-year DSS levels in patients with and without LR was 44% and 73.8%, respectively.

Conclusions: We recommend that patients undergoing surgery underwent unplanned given standard treatment, including the option to amputation because here, LR proved to be a risk factor for decreased DSS.

The Pathogenesis and Prevention Port-Site Metastasis in Gynecologic Oncology

Port-site metastases (PSM) is a specific and challenging complications of laparoscopic gynecologic oncology procedures. Research has shown that PSM is associated with morbidity and poor results. The exact pathogenesis of PSM in gynecological patients is not clear. Some precautions of PSM has been discussed in the relevant literature, and novel approaches to prevent this complication rarely keep up. In this review, we summarize the potential mechanisms of PSM and discuss the controversy and benefits of measures proposed prevention of PSM in gynecologic oncology.

We conducted a literature search using Medline database to identify studies of the pathogenesis and prevention of laparoscopic PSM. The hypothesis of the pathogenesis PSM at the center of the body’s immune response, pneumoperitoneum, contamination of wounds and surgical methods. convincing evidence of effective prevention of PSM after laparoscopic surgery is less. traditional preventive measures such as irrigation and tumor manipulation must be taken individually.

CO2 insufflation Hyperthermic and humidified CO2 leads to better outcomes in patients with malignant tumors who underwent laparoscopic procedures with the CO2 pneumoperitoneum than normal. Port-resection site showed no advantage in survival and outcome in the event of more injuries. PSM prevention plays an important part in the overall care of patients with gynecological malignancies who underwent laparoscopic procedures.

 Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group
Standard Treatment Remains the Recommended Approach for Patients with Bone Sarcoma Who Underwent Unplanned Surgery: Report from the Japanese Musculoskeletal Oncology Group

End of the decision on the limitation of treatment in patients with cancer: an empirical analysis of the end-of-life practice of hematology and oncology unit at a university hospital in Germany

Background: The decision to limit treatment (DLTs) were essential to protect patients from overtreatment but it is one of the most ethically challenging situations in the practice of oncology. Ethics Policy Planning in Advance Care and Treatment study Limiting (EPAL), we examined how often DLT preceded the death of the patient and how early they were determined before (T1) and after (T2) the implementation of ethics policies intrainstitutional in DLT.

Methods: This prospective quantitative recruited 1,134 patients with hematology / oncology neoplasia within a period of 2 × 6 months at the Hospital of the University of Munich, Germany. Information on admission, discharge, diagnosis, age, DLT, date and place of death, and the time span between the initial determination of the DLT and the death of a patient are recorded using a standard form.

Results: Overall, 21% (n = 236) of the 1,134 patients, DLT was made. After the implementation of the policy, the proportion of reduction (26% T1 / T2 16%). However, the decision was more comprehensive, including more frequent combinations of ‘Do Not Resuscitate’ and ‘no intensive care unit’ (44% T1 / T2 64%). The median time between the determination of DLT and the patient’s death is equally short with 6 days in regular wards (each T1 / T2) and 10.5 / 9 (T1 / T2) days in the palliative care unit. For patients with solid tumors, DLTs made earlier in both routine and palliative care units than the deceased with hematologic neoplasia.

Mouse FLT-4/VEGFR-3 Control/blocking peptide #1

FLT41-P 100 ug
EUR 164

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT12-M 100 ug
EUR 482

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT14-M 100 ug
EUR 482

VEGFR-2, human recombinant protein

P1080-.1 100 µg
EUR 1929
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure

FLT15-A 100 ul
EUR 482

Human FLT-4/VEGFR-3 control/blocking peptide #2

FLT42-P 100 ug
EUR 164

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 280

Rabbit Anti-Mouse FLT-4/VEGFR-3 IgG #1, aff pure

FLT41-A 100 ug
EUR 482

VEGFR Tyrosine Kinase Inhibitor II

C4603-1 1 mg
EUR 118

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

Anti-Flt-1 antibody

STJ98080 100 µl
EUR 234
Description: Mouse monoclonal to Flt-1.

Anti-Flt-1 antibody

STJ93093 200 µl
EUR 197
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody

STJ93094 200 µl
EUR 197
Description: Rabbit polyclonal to Flt-1.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 128
Description: HIV-1 Tat Protein Peptide

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein

PROTP01275-1 Regular: 50ug
EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

Anti-PARP-1 Antibody

A00122-1 100ul
EUR 397
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse.

Anti-Presenilin 1 Antibody

A00138-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat.

Anti-PAI-1 Antibody

A00637-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat.

Anti-Flk-1 Antibody

A00901-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse.

Anti-EDG-1 Antibody

A01502-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat.

Anti-ROBO-1 Antibody

A01530-1 100ug
EUR 455
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-TFIIIB90-1 Antibody

A03761-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TFIIIB90-1 Antibody (BRF1) detection.tested for WB in Human, Mouse.

Anti-Atrophin-1 Antibody

A03828-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Atrophin-1 Antibody (ATN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-CNG-1 Antibody

A05494-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for CNG-1 Antibody (CNGA1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Periphilin 1 Antibody

A06996-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse.

Anti-Lyl-1 Antibody

A07491-1 100ul
EUR 397
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat.

Anti-GLI-1 Antibody

A07972-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Cerebellin 1 Antibody

A09176-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-DOC-1 Antibody

A09467-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for DOC-1 Antibody (CDK2AP1) detection. Tested with WB in Human, Mouse.

Anti-Bag-1 Antibody

A02423-1 50 ul
EUR 397
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat.

Anti-TUB 1 Antibody

A02917-1 100ug/vial
EUR 294

Anti-Dok-1 Antibody

A03039-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Dok-1 Antibody (DOK1) detection.tested for WB in Human, Mouse, Rat.

Anti-NPDC-1 Antibody

A12846-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for NPDC-1 Antibody (NPDC1) detection. Tested with WB in Human, Mouse, Rat.

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0001 1.0mg
EUR 576
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0005 5.0mg
EUR 2207
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 235

Rabbit Anti-Human FLT-4/VEGFR-3 IgG #2, aff pure

FLT42-A 100 ug
EUR 482

Anti-Apaf-1 (human) Monoclonal Antibody (2E12)

M00889-1 100ug
EUR 432
Description: Rat Monoclonal Apaf-1 (human) Antibody (2E12). Validated in ELISA, IP, IF, WB and tested in Human.

Anti-HO-1 Monoclonal Antibody (HO-1-2)

M00253-1 1mg
EUR 397
Description: Mouse Monoclonal HO-1 Antibody (HO-1-2). Validated in Flow Cytometry, IHC, WB and tested in Human, Mouse, Rat.

C-type natriuretic peptide (1-22) (human, rat, swine)

B5441-1 1 mg
EUR 276

Anti-Esrp-1 Monoclonal Antibody

M06068-1 100uL
EUR 443
Description: Mouse Monoclonal Esrp-1 Antibody. Validated in WB and tested in Human.

Anti-Presenilin 1 Monoclonal Antibody

M00138-1 100ug
EUR 397
Description: Rabbit Monoclonal Presenilin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Galectin 1 Monoclonal Antibody

M00470-1 100ug
EUR 397
Description: Rabbit Monoclonal Galectin 1 Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat.

Anti-DJ-1 Monoclonal Antibody

M00757-1 100ul
EUR 397
Description: Mouse Monoclonal DJ-1 Antibody. Validated in IHC, WB and tested in Bovine, Human.

Anti-Enolase 1 Monoclonal Antibody

M01250-1 100ul
EUR 397
Description: Anti-Enolase 1 Monoclonal Antibody tested in WB, IF, ICC, IHC, reactive to Human, rat, mouse, cow, pig, horse

Anti-Dynamin 1 Monoclonal Antibody

M02536-1 100ug
EUR 397
Description: Rabbit Monoclonal Dynamin 1 Antibody. Validated in IF, WB and tested in Human, Mouse, Rat.

Anti-Angiopoietin 1/ANGPT1 Antibody

PA1333-1 100ug/vial
EUR 334

Anti-Galectin 1/LGALS1 Antibody

PB9240-1 100ug/vial
EUR 334

Anti-TNF Receptor 1 Antibody

A00294-1 200ug
EUR 522
Description: Rabbit Polyclonal TNF Receptor 1 Antibody. Validated in IP, IHC, WB and tested in Human, Mouse, Rat.

Anti-Galectin 1/Lgals1 Antibody

A00470-1 100ug/vial
EUR 334

Anti-LOX-1/OLR1 Antibody

A00760-1 100ug/vial
EUR 294

Anti-Syndecan-1/SDC1 Antibody

A00991-1 100ug/vial
EUR 294

Anti-IRAK-1/IRAK1 Antibody

A01021-1 100ug/vial
EUR 334

Anti-Neurexin 1/NRXN1 Antibody

A01490-1 100ug/vial
EUR 334

Anti-Hexokinase 1/HK1 Antibody

A01504-1 100ug/vial
EUR 334

Anti-Musashi 1/Msi1 Antibody

A05052-1 100ug/vial
EUR 334

Anti-Pyrophosphatase 1/PPA1 Antibody

A07485-1 100ug/vial
EUR 334

Anti-TCP-1 eta Antibody

A08169-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCP-1 eta Antibody (CCT7) detection. Tested with WB in Human, Mouse, Rat.

Anti-Relaxin 1/RLN1 Antibody

A08367-1 100ug/vial
EUR 334

Anti-TCP-1 zeta Antibody

A09373-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCP-1 zeta Antibody (CCT6A) detection.tested for WB in Human, Mouse, Rat.

Anti-Synaptotagmin 1/SYT1 Antibody

A02314-1 100ug/vial
EUR 334

Anti-Syntenin-1 Monoclonal Antibody

A02475-1 100ul
EUR 397
Description: Mouse Monoclonal Antibody for Syntenin-1 Antibody (SDCBP) detection. Tested with WB in Human, Rat, Dog, Pig.

Anti-Dsg1/Desmoglein 1 Antibody

A02655-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Dsg1 Antibody (DSG1) detection.tested for IHC, WB in Human, Mouse, Rat.

Anti-CAF-1 p150 Antibody

A02732-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for CAF-1 p150 Antibody (CHAF1A) detection. Tested with WB in Human, Mouse.

Anti-Talin 1/TLN1 Antibody

A02859-1 100ug/vial
EUR 334

Anti-Islet 1/ISL1 Antibody

A02969-1 100ug/vial
EUR 334

Anti-CHST8/Galnac4St 1 Antibody

A10989-1 100ul
EUR 397
Description: Rabbit Polyclonal CHST8/Galnac4St 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

VEGFR-1 Antibody

48347-100ul 100ul
EUR 333

VEGFR-1 Antibody

48347-50ul 50ul
EUR 239

Anti-P-glycoprotein (human) Monoclonal Antibody (JSB-1)

M00049-1 125ug
EUR 586
Description: Mouse Monoclonal P-glycoprotein (human) Antibody (JSB-1). Validated in IF and tested in Human.

Lytic Peptide, Shiva ? 1

SP-88327-1 1 mg
EUR 347

Anti-Peptide YY/PYY Antibody

A04223-1 100ug/vial
EUR 334

Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378

M04431-1 100uL
EUR 385
Description: Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 tested in WB, IHC, reactive to Human

AXMIR-1 RNA oligo anti-miRNA-1-3p with Xmotif

AXMIR-1 10 reactions
EUR 438

Anti-Sumo 1 Rabbit Monoclonal Antibody

M00631-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Sumo 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Cytokeratin 1 Rabbit Monoclonal Antibody

M01639-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Cytokeratin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Mitofusin 1 Antibody (monoclonal, 3H3)

M02172-1 100ug/vial
EUR 294

Anti-Phospho-Beclin-1 (Ser295) Antibody

P00327-1 100ul
EUR 398
Description: Rabbit Polyclonal Phospho-Beclin-1 (Ser295) Antibody. Validated in WB and tested in Human.

Anti-Phospho-Raf-1 (Ser642) Antibody

P00446-1 100ul
EUR 398
Description: Rabbit Polyclonal Phospho-Raf-1 (Ser642) Antibody. Validated in WB and tested in Human, Rat.

Anti-Integrin alpha 1/ITGA1 Antibody

PA1045-1 100ug/vial
EUR 334

Anti-Caspase-1(P20)/CASP1 Antibody

PA1440-1 100ug/vial
EUR 294

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-1 100ug/vial
EUR 294

Anti-HIF-1 alpha/HIF1A Antibody

A00013-1 100ug/vial
EUR 294

Anti-Cleaved-Notch 1 (V1754) Antibody

A00033-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Cleaved-Notch 1 (V1754) Antibody (NOTCH1) detection.tested for WB in Human, Mouse, Rat.

Anti-HDAC-1 (C-terminus) Antibody

A00256-1 100uL
EUR 443
Description: Rabbit Polyclonal HDAC-1 (C-terminus) Antibody. Validated in IF, IHC, WB and tested in Human.

Anti-VEGF Receptor 1/FLT1 Antibody

A00534-1 100ug/vial
EUR 294

Anti-Liver Carboxylesterase 1/CES1 Antibody

A01741-1 100ug/vial
EUR 334

Anti-Hyaluronan synthase 1/HAS1 Antibody

A04784-1 100ug/vial
EUR 334

Anti-CELSR3/Flamingo Homolog 1 Antibody

A07204-1 100ul
EUR 397
Description: Rabbit Polyclonal CELSR3/Flamingo Homolog 1 Antibody. Validated in IF and tested in Human, Mouse, Rat.

Anti-LPCAT2/Acyltransferase Like 1 Antibody

A07471-1 100ul
EUR 397
Description: Rabbit Polyclonal LPCAT2/Acyltransferase Like 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-EBP50/NHERF-1/SLC9A3R1 Antibody

A02427-1 100ug/vial
EUR 334

Anti-IL1R2/Il 1 Rii Antibody

A03106-1 1 ml
EUR 397
Description: Rabbit Polyclonal IL1R2/Il 1 Rii Antibody. Validated in IP, WB and tested in Human.


DB-089-1 1 ml
EUR 750
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-HLA-G (human) Monoclonal Antibody (MEM-G/1)

M01235-1 100ug
EUR 397
Description: Mouse Monoclonal HLA-G (human) Antibody (MEM-G/1). Validated in IHC, WB and tested in Human.

VEGFR-1/Flt1/ Rat VEGFR- 1/ Flt1 ELISA Kit

ELA-E0147r 96 Tests
EUR 886

Anti-Phospho-Flt-1 (Y1048) antibody

STJ91223 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Flt-1 (Y1048).

Anti-Phospho-Flt-1 (Y1213) antibody

STJ91359 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Flt-1 (Y1213).

Anti-Flk-1/Flt-4 antibody

STJ93091 200 µl
EUR 197
Description: Rabbit polyclonal to Flk-1/Flt-4.

Anti-Phospho-Flt-1 (Y1333) antibody

STJ90838 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Flt-1 (Y1333).

Endothelin-1 (1-15), amide, human

A1111-1 1 mg
EUR 722
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Haptoglobin, (Phenotype 1-1) Human Plasma

EUR 321

Mouse FLK-1/VEGFR-2 control/blocking peptide # 1

FLK11-P 100 ug
EUR 164

Human/Rat/Mouse PLP104-117 peptide, depalmitoylated

PLP104-1-1 1 mg
EUR 141

Human/Rat/Mouse PLP178-191 peptide, depalmitoylated

PLP178-1-1 1 mg
EUR 141

Human/Rat/Mouse PLP40-59 peptide, depalmitoylated

PLP40-1-1 1 mg
EUR 141

Hemokinin 1 (human)

B5318-1 1 mg
EUR 340

Anti-Musashi 1/Msi1 Antibody (monoclonal, 2B9)

M05052-1 100ug/vial
EUR 334

Anti-Visinin-like Protein 1 Monoclonal Antibody

M06959-1 100ul
EUR 397
Description: Mouse Monoclonal Visinin-like Protein 1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-HMGB1/Hmg 1 Rabbit Monoclonal Antibody

M00066-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal HMGB1/Hmg 1 Antibody. Validated in Flow Cytometry, IF, IHC, ICC, WB and tested in Human, Mouse, Rat.

Anti-p27 KIP 1 Rabbit Monoclonal Antibody

M00173-1 100ug/vial
EUR 397
Description: Anti-p27 KIP 1 Rabbit Monoclonal Antibody tested for Flow Cytometry, IP, IF, IHC, ICC, WB in Human, Rat

Anti-Caveolin-1/CAV1 Antibody (monoclonal, 12C7)

M00179-1 100ug/vial
EUR 334

Anti-MHC class 1 Rabbit Monoclonal Antibody

M00194-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal MHC class 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human.

Anti-Integrin beta 1 Rabbit Monoclonal Antibody

M00772-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Integrin beta 1 Antibody. Validated in IHC, WB and tested in Human, Mouse, Rat.

Anti-ARG1/Arginase 1 Rabbit Monoclonal Antibody

M01106-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal ARG1/Arginase 1 Antibody. Validated in IP, WB and tested in Human, Mouse, Rat.

Anti-MLANA/Mart 1 Rabbit Monoclonal Antibody

M02033-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal MLANA/Mart 1 Antibody. Validated in IF, WB and tested in Human.

Anti-TCP-1α Monoclonal Antibody (91a)

M02389-1 200ug
EUR 498
Description: Rat Monoclonal TCP-1α Antibody (91a). Validated in Flow Cytometry, IP, IF, WB and tested in Human, Mouse, Rat.

Anti-DSG1/Desmoglein 1 Rabbit Monoclonal Antibody

M02655-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal DSG1/Desmoglein 1 Antibody. Validated in IF, IHC, ICC, WB and tested in Human, Mouse, Rat.

Anti-Phospho-Glycogen Synthase 1 (S645) Antibody

P03512-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Phospho-Glycogen Synthase 1 (S645) Antibody (GYS1) detection.tested for WB in Human, Mouse, Rat.

Anti-Angiotensin Converting Enzyme 1/ACE Antibody

PA2196-1 100ug/vial
EUR 334

Anti-GABA B Receptor 1/GABBR1 Antibody

A07297-1 100ug/vial
EUR 294

Anti-Vangl1/Vang Like Protein 1 Antibody

A07587-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Vangl1 Antibody (VANGL1) detection. Tested with WB in Human, Mouse.

Anti-E74 like factor 1/ELF1 Antibody

A03187-1 100ug/vial
EUR 294

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein

P1054-1 1 mg
EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

Human/Rat/Mouse PLP139-151 (S140) peptide, depalmitoylated

PLP139-1-1 1 mg
EUR 141

miRZip-1 anti-miR-1 microRNA construct

MZIP1-PA-1 Bacterial Streak
EUR 684


DB-060-1 1 ml
EUR 750
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated


DB-061-1 1 ml
EUR 750
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein

PROTP03956-1 Regular: 20ug
EUR 317
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

Anti-AFP/Alpha 1 Fetoprotein Rabbit Monoclonal Antibody

M00522-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal AFP/Alpha 1 Fetoprotein Antibody. Validated in IP, IF, WB and tested in Human.

Anti-SERPINA1/Alpha 1 Antitrypsin Rabbit Monoclonal Antibody

M00720-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal SERPINA1/Alpha 1 Antitrypsin Antibody. Validated in IP, IF, WB and tested in Human.

Anti-GPX1/Glutathione Peroxidase 1 Rabbit Monoclonal Antibody

M01019-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal GPX1/Glutathione Peroxidase 1 Antibody. Validated in IP, WB and tested in Human, Mouse, Rat.

Anti-BAG-1 Rabbit Monoclonal Antibody, Clone#RM356

M02423-1 100uL
EUR 385
Description: Anti-BAG-1 Rabbit Monoclonal Antibody, Clone#RM356 tested in WB, IHC, reactive to Human

Anti-Mitochondrial Pyruvate dehydrogenase kinase 1/PDK1 Antibody

A01268-1 100ug/vial
EUR 334

XStamp Pro anti-PD-1 EV Targeting Kit

XSTP915A-1 10 rxn
EUR 805

IGF-1, human recombinant

P1016-.1 100 µg
EUR 763
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

BNP (1-32), human

A1105-1 1 mg
EUR 177
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

Atrial Natriuretic Peptide (1-28), Rat

SP-55278-1 0.5 mg
EUR 286

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein

PROTO75771-1 Regular: 10ug
EUR 317
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9

PROTQ01638-1 Regular: 10ug
EUR 317
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

Anti-Phospho-AMPK alpha 1 (S496) Rabbit Monoclonal Antibody

P00994-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Phospho-AMPK alpha 1 (S496) Antibody. Validated in IP, IF, WB and tested in Human.

CF350 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20245-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF488A Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20246-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF555 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20247-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF568 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20248-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF594 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20249-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF633 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20250-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF640R Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20251-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF647 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20252-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF680 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20253-1 50uL
EUR 161
Description: Minimum order quantity: 1 unit of 50uL

CF770 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20254-1 50uL
EUR 161
Description: Minimum order quantity: 1 unit of 50uL

CF543 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20325-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

Flt-1 Polyclonal Antibody

ES5317-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Flt-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Flt-1 Polyclonal Antibody

ES5318-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Flt-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Flt-1 Polyclonal Antibody

ES5317-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Flt-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Flt-1 Polyclonal Antibody

ES5318-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Flt-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Flt-1 Polyclonal Antibody

ABP54318-003ml 0.03ml
EUR 158
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048

Flt-1 Polyclonal Antibody

ABP54318-01ml 0.1ml
EUR 289
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048

Flt-1 Polyclonal Antibody

ABP54318-02ml 0.2ml
EUR 414
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048

Flt-1 Polyclonal Antibody

ABP54319-003ml 0.03ml
EUR 158
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1333

Flt-1 Polyclonal Antibody

ABP54319-01ml 0.1ml
EUR 289
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1333

Flt-1 Polyclonal Antibody

ABP54319-02ml 0.2ml
EUR 414
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1333

Anti-EMA (CD227, Mucin-1)

DB-048-1 1 ml
EUR 450
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

VEGF receptor Flt-1 (F56), Peptide Aptamer, Biotinylated

AP-334-B 1 mg Ask for price

VEGF receptor Flt-1 (F56), Peptide Aptamer, unlabeled

AP-334-U 5 mg Ask for price

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

PROTP11464-1 Regular: 10ug
EUR 317
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

Calcitonin, Human (Synthetic peptide)

EUR 185

GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein

PROTQ99259-1 Regular: 20ug
EUR 317
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

TGF-b-1 Transforming Growth Factor-beta 1 Human protein

PROTP01137-1 Regular: 2.5ug
EUR 1157
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)

PROTP13500-1 Regular: 20ug
EUR 317
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 477

Human Interleukin-1-alpha (IL-1-alpha) AssayMax ELISA Kit

EI2301-1 96 Well Plate
EUR 477

Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit

EK2802-1 96 Well Plate
EUR 477

Human Plasminogen Activator Inhibitor-1 (PAI-1) AssayMax ELISA Kit

EP1100-1 96 Well Plate
EUR 417

Recombinant Human ANG-1 Protein

PROTQ15389-1 20ug
EUR 317
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

ORM1 Orosomucoid 1 Human protein

PROTP02763-1 Regular: 10ug
EUR 317
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.

Conclusions: Our results show that the ethics policy in DLT be sensitive to the limitations of treatment in terms of frequency and extension but did not have a significant impact on the time DLT. Since patients with hematological malignancies tend to undergo intensive therapy more frequently during their final days than patients with solid tumors, particular attention should be given to this group. To support the timely discussion, we suggest that the concept of advance care planning.

Related Posts

Leave a Reply

Your email address will not be published.