Role of implicit bias in pediatric cancer clinical trials and enrollment recommendations among pediatric oncology providers

Background: Provider implicit bias could negatively affect the doctor-patient communication. In this study, the authors measured implicit bias training in pediatric oncology providers and exposure implicit association test (IATs). They then assessed the association between IATs to race and socioeconomic status (SES) and the recommendation for the registration of clinical trials.

Methods: A prospective multisite study conducted to measure implicit bias among providers of oncology at the Hospital St. Jude Children’s Research and affiliated clinics. An IAT is used to assess the bias in the domain of race and SES. sketches of use cases to determine the relationship between bias and provider recommendation for trial registration. Data were analyzed using Student’s t test or Wilcoxon test for the comparison and the Jonckheere-Terpstra test is used for the association.

Results: Of the 105 number of the participants, 95 (90%) did not take an IAT and 97 (92%) do not have an implicit bias training before. A great effect was found for (bias towards) high SES (Cohen d, 1.93) and the European American race (Cohen d, 0.96). The majority of participants (90%) had a score sketch of 3 or 4, which indicates the recommendation for trial enrollment for part or the entire sketch. IAT and vignette scores did not significantly differ between providers on the Hospital St. Jude Children’s Research or affiliated clinics. No relationship was found between IAT and score sketches for the race (P = 0.58) or SES (P = 0.82).

Conclusions: The authors noted deficiencies prior exposure bias implicit self-assessment and training. Although providers show a preference for high SES and racial America Europe, this does not seem to affect the recommendation for registration of clinical trials that assessed by the sketch.

Through the years the ability to suppress angiogenesis has been utilized in the field of oncology. This efficiency is well documented and indications continue to grow, although the impact is often somewhat limited, as we argue in this review. Recent evidence suggests that angiogenesis inhibition may be a clinically meaningful treatment through several channels but less than the limit biomarker individual approach. The tumor microenvironment are anti-immune and anti-angiogenic drug combinations and immunotherapy has demonstrated impressive results and can change therapy in the years to come.

COVID-19 Pandemic Impact on Student and Resident Teaching and Training in Surgical Oncology

The COVID 19th pandemic has greatly changed the personal and professional interactions and behaviors worldwide. The effects of this pandemic and the measures taken have changed our health system, which in turn has affected the surgical medical education and training. In the face of constant interruption of surgical education and training during the pandemic outbreak, structured and innovative concepts and customized curriculum that is important to ensure the high quality of medical care. While efforts were made to prevent the virus from spreading, it is important to analyze and assess the impact of this crisis on medical education, surgical training and teaching in general and certainly in the field of surgical oncology.

Against this background, in this paper we introduce a practical and creative recommendations for the continuity of students and residents training and medical and surgical teaching. It includes a virtual curriculum of education, skill development classes, video-based feedback and simulation in the field of oncology surgical specialties. In conclusion, the effect COVID 19 Surgical Training and Teaching, certainly in the field of Surgical Oncology, challenging.

 Role of implicit bias in pediatric cancer clinical trials and enrollment recommendations among pediatric oncology providers
Role of implicit bias in pediatric cancer clinical trials and enrollment recommendations among pediatric oncology providers

Multiomic General Oncology Database Integration in Bioconductor

Objective: Investigation of the molecular basis for the development, progress and treatment of cancer are increasingly using complementary genomic tests to collect data multiomic, but the management and analysis of the data is still complex. The cBioPortal for genomics of cancer today provides data multiomic of> 260 general studies, including The Cancer Genome Atlas (TCGA) set of data, but the integration of various types of data the remains challenging and error prone to computational methods and tools to use these resources , The latest advances in data infrastructure in Bioconductor project enables new and powerful approach to creating this integrated representation multiomic, pan-cancer database

.
Methods: We provide a set of packages R / Bioconductor to work with legacy data and data TCGA cBioPortal, with special consideration for the loading time; efficient representation in and out of memory; Analytics platform; and integrative framework, as MultiAssayExperiment.

Porcine VEGFR-1/Flt1 ELISA Kit

EPV0045 96Tests
EUR 625.2

Mouse VEGFR-1/Flt1 ELISA Kit

EMV0045 96Tests
EUR 625.2

Rabbit VEGFR-1/Flt1 ELISA Kit

ERTV0045 96Tests
EUR 625.2

Rat VEGFR-1/Flt1 ELISA Kit

ERV0045 96Tests
EUR 625.2

Goat VEGFR-1/Flt1 ELISA Kit

EGTV0045 96Tests
EUR 625.2

Anserini VEGFR-1/Flt1 ELISA Kit

EAV0045 96Tests
EUR 625.2

Bovine VEGFR-1/Flt1 ELISA Kit

EBV0045 96Tests
EUR 625.2

Canine VEGFR-1/Flt1 ELISA Kit

ECV0045 96Tests
EUR 625.2

Anti-Flt1 Peptide

5-00708 4 x 5mg Ask for price

Anti-Flt1 Peptide

20-abx265801
  • EUR 393.60
  • EUR 594.00
  • EUR 326.40
  • 10 mg
  • 25 mg
  • 5 mg

Guinea Pig VEGFR-1/Flt1 ELISA Kit

EGV0045 96Tests
EUR 625.2

Anti-VEGF Receptor 1/FLT1 Antibody

A00534-1 100ug/vial
EUR 352.8

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-1 100ug/vial
EUR 352.8

Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) ELISA kit

1-CSB-E11885h
  • EUR 813.60
  • EUR 5572.80
  • EUR 2960.40
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

VEGFR-2, human recombinant protein

P1080-.1 100 µg
EUR 2314.8
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 ELISA kit

1-CSB-E04762m
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 ELISA Kit

1-CSB-E07350r
  • EUR 867.60
  • EUR 5859.60
  • EUR 3109.20
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

FLT1 Blocking Peptide

BF0131-BP 1mg
EUR 234

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0001 1.0mg
EUR 691.2
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0005 5.0mg
EUR 2648.4
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 336

Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) ELISA kit

CSB-E11885h-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0265HM-48T 48T
EUR 346.8

Human Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0265HM-96T 96T
EUR 559.2

Human Vascuoar endothelial cell growth factor receptor 1,VEGFR-1/Flt1 ELISA kit

201-12-0249 96 tests
EUR 528
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

QY-E00705 96T
EUR 433.2

Heart Lysate (14 Days Old)

1401-14 0.1 mg
EUR 229.2
Description: Heart tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Lung Lysate (14 Days Old)

1402-14 0.1 mg
EUR 229.2
Description: Lung tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Brain Lysate (14 Days Old)

1403-14 0.1 mg
EUR 229.2
Description: Brain tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Liver Lysate (14 Days Old)

1404-14 0.1 mg
EUR 229.2
Description: Liver tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Kidney Lysate (14 Days Old)

1405-14 0.1 mg
EUR 229.2
Description: Kidney tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Spleen Lysate (14 Days Old)

1406-14 0.1 mg
EUR 229.2
Description: Spleen tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Thymus Lysate (14 Days Old)

1409-14 0.1 mg
EUR 229.2
Description: Thymus tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Stomach Lysate (14 Day Old)

1415-14 0.1 mg
EUR 229.2
Description: Stomach tissue lysate (14 Day Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Skin Lysate (14 Days Old)

1419-14 0.1 mg
EUR 229.2
Description: Skin tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Eye Lysate (14 Days Old)

1420-14 0.1 mg
EUR 229.2
Description: Eye tissue lysate (14 Days Old) was prepared by homogenization in modified RIPA buffer (150 mM sodium chloride, 50 mM Tris-HCl, pH 7.4, 1 mM ethylenediaminetetraacetic acid, 1 mM phenylmethylsulfonyl fluoride, 1% Triton X-100, 1% sodium deoxycholic acid, 0.1% sodium dodecylsulfate, 5 μg/ml of aprotinin, 5 μg/ml of leupeptin. Tissue and cell debris was removed by centrifugation. Protein concentration was determined with Bio-Rad protein assay. The product was boiled for 5 min in 1 x SDS sample buffer (50 mM Tris-HCl pH 6.8, 12.5% glycerol, 1% sodium dodecylsulfate, 0.01% bromophenol blue) containing 50 mM DTT.

Human FLT-1/VEGFR-1 Control/blocking peptide #1

FLT11-P 100 ug
EUR 196.8

anti- VEGFR-1/FLT-1 antibody

FNab09393 100µg
EUR 606.3
Description: Antibody raised against VEGFR-1/FLT-1

Anti-VEGFR-1/FLT-1 antibody

PAab09393 100 ug
EUR 426

VEGFR Tyrosine Kinase Inhibitor II

C4603-1 1 mg
EUR 141.6

Anti-Peroxin 14 Antibody

A03327-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Peroxin 14 Antibody (PEX14) detection.tested for WB in Human, Mouse, Rat.

Anti-Cytokeratin 14

DB-099-1 1 ml
EUR 621.6
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 ELISA kit

CSB-E04762m-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 ELISA Kit

CSB-E07350r-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0125MS-48T 48T
EUR 403.2

Mouse Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0125MS-96T 96T
EUR 640.8

Rat Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0671RT-48T 48T
EUR 380.4

Rat Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0671RT-96T 96T
EUR 595.2

Rat Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

QY-E10981 96T
EUR 433.2

Mouse Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

QY-E21586 96T
EUR 433.2

VEGFR-1 Antibody

48347-100ul 100ul
EUR 399.6

VEGFR-1 Antibody

48347-50ul 50ul
EUR 286.8

anti-FLT1 (3D10)

LF-MA30315 100 ul
EUR 583.2
Description: Mouse Monoclonal to FLT1

Anti-FLT1 antibody

STJ111066 100 µl
EUR 332.4
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Anti-FLT1 antibody

STJ112545 100 µl
EUR 332.4
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Anti-FLT1 antibody

STJ23673 100 µl
EUR 332.4
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Anti-FLT1 antibody

STJ27575 100 µl
EUR 332.4
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Anti-FLT1 Antibody

STJ503482 100 µg
EUR 571.2

Rabbit Polyclonal antibody Anti-CRBN

Anti-CRBN 50 µg
EUR 418.8

Anti-Siglec-5/14 Antibody

A06510-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Siglec-5/14 Antibody (SIGLEC5) detection.tested for IHC, WB in Human.

Mouse FLK-1/VEGFR-2 control/blocking peptide # 1

FLK11-P 100 ug
EUR 196.8

Gastrin I (1-14) (human)

SP-100258-1 1 mg
EUR 196.8

Gastrin Releasing Peptide (GRP) (14-27) (human, porcine, canine)

SP-100262-1 1 mg
EUR 343.2

Anti-14-3-3 epsilon Antibody

A01687-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for 14-3-3 epsilon Antibody (YWHAE) detection. Tested with WB, IHC in Mouse, Rat.

Anti-Cytokeratin 14 Rabbit Monoclonal Antibody

M01432-1 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Cytokeratin 14 Antibody. Validated in IP, IF, WB and tested in Human.

Anti-VEGF Receptor 1/FLT1 Antibody

A00534 100ug/vial
EUR 352.8

Anti-VEGF Receptor 1/FLT1 Antibody

PA1399 100ug/vial
EUR 352.8

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966 100ug/vial
EUR 352.8

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-2 100ug/vial
EUR 352.8

FLT1-D4 Vascular Endothelial Growth Factor Receptor-1 D4 Human Recombinant Protein

PROTP17948-1 Regular: 10ug
EUR 380.4
Description: Soluble FLT1 D1-4 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 457 amino acids and having a molecular mass of 55 kDa. The soluble receptor protein contains only the first 4 extracellular domains, which contain all the information necessary for binding of VEGF.;The VEGFR1 is purified by proprietary chromatographic techniques.

FLT1 Antibody

1-CSB-PA07269A0Rb
  • EUR 380.40
  • EUR 402.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC, IF; Recommended dilution: IHC:1:20-1:200, IF:1:50-1:200

FLT1 Antibody

1-CSB-PA008732GA01HU
  • EUR 716.40
  • EUR 399.60
  • 150ul
  • 50ul
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: ELISA, WB

FLT1 Antibody

1-CSB-PA008334
  • EUR 266.40
  • EUR 234.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;IHC:1/100-1/300.ELISA:1/10000

FLT1 Antibody

1-CSB-PA008335
  • EUR 266.40
  • EUR 234.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;IHC:1/100-1/300.ELISA:1/5000

Somatostatin-14 (7-14) Peptide

20-abx266001
  • EUR 460.80
  • EUR 710.40
  • EUR 360.00
  • 10 mg
  • 25 mg
  • 5 mg

beta Amyloid (1-14) Peptide

20-abx265397
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Somatostatin 28 (1-14) Peptide

20-abx266437
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Adrenocorticotropic Hormone (1-14) Peptide

20-abx266459
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Mouse FLT-4/VEGFR-3 Control/blocking peptide #1

FLT41-P 100 ug
EUR 196.8

Amyloid Beta Peptide 1-14 (Ab1-14) Antibody

abx411904-01ml 0.1 ml
EUR 610.8

Anti-FLT1 Antibody (Biotin)

STJ503483 100 µg
EUR 703.2

Anti-FLT1 Antibody (FITC)

STJ503484 100 µg
EUR 703.2

VEGFR-1 / FLT-1 Antibody

abx239393-100ug 100 ug
EUR 577.2

Anti-14-3-3 Rabbit Monoclonal Antibody

M02431-1 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal 14-3-3 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Cortistatin 14

B5416-1 1 mg
EUR 300

TAT 14

B5721-1 1 mg
EUR 388.8

Claudin 14 Peptide

45-040P 0.1 mg
EUR 405.6
Description: (CT) Claudin 14 / CLDN14 Peptide

Caspase-14 Peptide

2509P 0.05 mg
EUR 197.7
Description: (CT) Caspase-14 peptide

TRAP-14 Peptide

20-abx266463
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Peptide WE-14

H-8680.0001 1.0mg
EUR 529.2
Description: Sum Formula: C72H116N18O24S; CAS# [115136-18-0]

Peptide WE-14

H-8680.0005 5.0mg
EUR 2010
Description: Sum Formula: C72H116N18O24S; CAS# [115136-18-0]

Rabbit Anti-human FLT-1/VEGFR-1 IgG #1, aff pure

FLT11-A 100 ul
EUR 578.4

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 331.2

VEGFR Antibody

R30470 100 ug
EUR 419

DCIP-1, CXCL3, human

RC332-14 2ug
EUR 125.26

Human FLT-4/VEGFR-3 control/blocking peptide #2

FLT42-P 100 ug
EUR 196.8

IGF-1, Insulin-like Growth factor-1, human

RC216-14 5mg
EUR 728.16

Rat Vascuoar endothelial cell growth factor receptor 2(VEGFR-2/Flt1)ELISA Kit

GA-E0672RT-48T 48T
EUR 380.4

Rat Vascuoar endothelial cell growth factor receptor 2(VEGFR-2/Flt1)ELISA Kit

GA-E0672RT-96T 96T
EUR 595.2

Rat Vascuoar endothelial cell growth factor receptor 2(VEGFR-2/Flt1)ELISA Kit

QY-E10980 96T
EUR 433.2

Mouse Vascuoar endothelial cell growth factor receptor 2(VEGFR-2/Flt1)ELISA Kit

QY-E21587 96T
EUR 433.2

FLT1, human recombinant

4951-10
EUR 352.8

FLT1, human recombinant

4951-100
EUR 2173.2

MIP-1 alpha, CCL3, human

RC315-14 5ug
EUR 125.26

Anti-14-3-3 zeta/delta/YWHAZ Antibody

A01141-1 100ug/vial
EUR 400.8

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT12-M 100 ug
EUR 578.4

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT14-M 100 ug
EUR 578.4

[Tyr12]-Somatostatin-28 (1-14) Peptide

20-abx266445
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

PTH, Parathyroid Hormone (1-34), human

RC412-14 20ug
EUR 125.26

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 621.6

Drying Tube Angled Mf23/1 14/23

QMF23/1 EACH
EUR 31.19

Human Vascular endothelial growth factor receptor 1 (FLT1)

1-CSB-MP008732HU
  • EUR 327.60
  • EUR 1052.40
  • EUR 453.60
  • EUR 786.00
  • 100ug
  • 1MG
  • 200ug
  • 500ug
Description: Recombinant Human Vascular endothelial growth factor receptor 1(FLT1),partial expressed in Mammalian cell

HRP-Goat Anti-Mouse Secondary Antibody

A12003
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

HRP-Goat Anti-Rabbit Secondary Antibody

A12004
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Human Bombesin 1-14 aa full length peptide

BOM11-P 1 mg
EUR 343.2

Anti-Peptide YY/PYY Antibody

A04223-1 100ug/vial
EUR 400.8

Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated

A12001
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Goat Anti-Rat Secondary Antibody, Biotin Conjugated

A12002
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Caspase-14 Blocking Peptide

AF9035-BP 1mg
EUR 234

Keratin 14 Blocking Peptide

AF5225-BP 1mg
EUR 234

Keratin 14 Blocking Peptide

AF5370-BP 1mg
EUR 234

Keratin 14 Blocking Peptide

AF0736-BP 1mg
EUR 234

BMP-14 Blocking Peptide

5580BP-50
EUR 183.6

BMP 14 Blocking Peptide

33R-10578 50 ug
EUR 418.8
Description: A synthetic peptide for use as a blocking control in assays to test for specificity of BMP 14 antibody, catalog no. 20R-1824

Caspase-14 Blocking Peptide

3011BP-50
EUR 183.6

Cytokeratin 14 Blocking Peptide

20-abx162545
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Myosin 14 Blocking Peptide

20-abx061100
  • EUR 343.20
  • EUR 510.00
  • 1 mg
  • 5 mg

Cytokeratin 14 Blocking Peptide

20-abx062856
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

GRP (14-27) Peptide

20-abx265265
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Bombesin (8-14) Peptide

20-abx265960
  • EUR 460.80
  • EUR 710.40
  • EUR 360.00
  • 10 mg
  • 25 mg
  • 5 mg

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 108
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 477.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 613.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 484.8

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 667.2

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 464.4

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 638.4

ALS Style Puck; Qnty 14

M-CP-111-035-14 14 PUCKS
EUR 4250
Description: ALS Style Puck; Qnty 14

Polyclonal Goat anti-GST μ-form

GST-ANTI-2 50 uL
EUR 336

Polyclonal Goat anti-GST p-form

GST-ANTI-3 50 uL
EUR 336

FLT1 Antibody

CSB-PA277480-
EUR 402
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, WB;WB:1:500-1:1000

FLT1 Antibody

CSB-PA277480-100ul 100ul
EUR 379.2
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, WB;WB:1:500-1:1000

FLT1 siRNA

20-abx916980
  • EUR 661.20
  • EUR 878.40
  • 15 nmol
  • 30 nmol

FLT1 siRNA

20-abx916981
  • EUR 661.20
  • EUR 878.40
  • 15 nmol
  • 30 nmol

FLT1 Antibody

CSB-PA714296-
EUR 402
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;IHC:1:50-1:100

FLT1 Antibody

CSB-PA714296-100ul 100ul
EUR 379.2
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;IHC:1:50-1:100

FLT1 antibody

70R-17324 50 ul
EUR 522
Description: Rabbit polyclonal FLT1 antibody

FLT1 antibody

70R-13941 100 ug
EUR 386.4
Description: Affinity purified Rabbit polyclonal FLT1 antibody

FLT1 protein

30R-2788 10 ug
EUR 423.6
Description: Purified recombinant Human FLT1 protein

Flt1 antibody

20R-FR013 50 ug
EUR 787.2
Description: Rabbit polyclonal Flt1 antibody

Flt1 antibody

20R-FR014 50 ug
EUR 787.2
Description: Rabbit polyclonal Flt1 antibody

Flt1 antibody

10R-1863 100 ul
EUR 483.6
Description: Mouse monoclonal Flt1 antibody

Flt1 antibody

10R-F117a 100 ug
EUR 859.2
Description: Mouse monoclonal Flt1 antibody

FLT1 siRNA

20-abx901984
  • EUR 661.20
  • EUR 878.40
  • 15 nmol
  • 30 nmol

FLT1 Antibody

BF0131 200ul
EUR 540

VEGFR-3 Antibody

21410-100ul 100ul
EUR 302.4

VEGFR-3 Antibody

21410-50ul 50ul
EUR 224.4

Vandetanib (VEGFR inhibitor)

SIH-483-10MG 10 mg
EUR 145.2
Description: The substance Vandetanib is a vegfr inhibitor. It is synthetically produced and has a purity of ?98%. The pure substance is yellow solid which is soluble in DMSO (30 mg/ml) or EtOH (10 mg/ml).

Vandetanib (VEGFR inhibitor)

SIH-483-50MG 50 mg
EUR 346.8
Description: The substance Vandetanib is a vegfr inhibitor. It is synthetically produced and has a purity of ?98%. The pure substance is yellow solid which is soluble in DMSO (30 mg/ml) or EtOH (10 mg/ml).

Biotinylated-Mouse Monoclonal Anti-Human FLK-1/VEGFR-2 IgG # 3

FLK13-MB 100 ug
EUR 489.6

Human Keratin 14 Differentiation Reporter (pGreenZeo, Plasmid)

SR10038PA-1 10 ug
EUR 2098.8

Human Keratin 14 Differentiation Reporter (pGreenZeo, Virus)

SR10038VA-1 >2 x 10^6 IFUs
EUR 906

TSH (Thyrotrophin) ELISA test

14 96T/Box Ask for price
Description: ELISA based test for quantitative detection of TSH (Thyrotrophin)

Human VEGFR 3 ELISA Kit

EHV0018 96Tests
EUR 625.2

VEGFR-2, human recombinant protein

P1080-.01 10 µg
EUR 375.6
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

QuickDetect? VEGFR (Human) ELISA Kit

K4426-100
EUR 705.6

Human FLT1 shRNA Plasmid

20-abx951625
  • EUR 961.20
  • EUR 1345.20
  • 150 µg
  • 300 µg

Human FLT1 ELISA Kit

ELA-E0147h 96 Tests
EUR 988.8

FLT1 Antibody, HRP conjugated

1-CSB-PA07269B0Rb
  • EUR 380.40
  • EUR 402.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is HRP conjugated. Tested in the following application: ELISA

FLT1 Antibody, FITC conjugated

1-CSB-PA07269C0Rb
  • EUR 380.40
  • EUR 402.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is FITC conjugated. Tested in the following application: ELISA

FLT1 Antibody, Biotin conjugated

1-CSB-PA07269D0Rb
  • EUR 380.40
  • EUR 402.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Biotin conjugated. Tested in the following application: ELISA

Phospho-FLT1 (Y1333) Antibody

1-CSB-PA000703
  • EUR 266.40
  • EUR 234.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against Phospho-FLT1 (Y1333). Recognizes Phospho-FLT1 (Y1333) from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;WB:1/500-1/2000.IHC:1/100-1/300.ELISA:1/40000

Phospho-FLT1 (Y1048) Antibody

1-CSB-PA000747
  • EUR 266.40
  • EUR 234.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against Phospho-FLT1 (Y1048). Recognizes Phospho-FLT1 (Y1048) from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;IHC:1/100-1/300.ELISA:1/5000

Phospho-FLT1 (Y1213) Antibody

1-CSB-PA000751
  • EUR 266.40
  • EUR 234.00
  • 100ug
  • 50ug
Description: A polyclonal antibody against Phospho-FLT1 (Y1213). Recognizes Phospho-FLT1 (Y1213) from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, ELISA;WB:1/500-1/2000.ELISA:1/40000

anti-Caveolin-1 (Ab-14)

LF-PA20068 100 ul
EUR 400.8
Description: Rabbit polyclonal to Caveolin-1

Masterflex L/S C-Flex Tubing 50 A L/S 14 25 ft

WZ-06424-14 EA
EUR 82.08

KRT14 Human, Cytokeratin 14 Human Recombinant Protein, His Tag

PROTP02533-1 Regular: 20ug
EUR 380.4
Description: KRT14 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 492 amino acids (1-472 a.a.) and having a molecular mass of 53.8kDa.;KRT14 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Anti-FLT1 (Icrucumab)-SMCC-DM1 ADC

ADC-W-1148 1mg Ask for price
Description: This ADC product is comprised of an anti-FLT1 monoclonal antibody conjugated via a SMCC linker to DM1

Anti-FLT1 (Icrucumab)-SPDB-DM4 ADC

ADC-W-1149 1mg Ask for price
Description: This ADC product is comprised of an anti-FLT1 monoclonal antibody conjugated via a SPDB linker to DM4

Anti-FLT1 (Icrucumab)-MC-MMAF ADC

ADC-W-1150 1mg Ask for price
Description: This ADC product is comprised of an anti-FLT1 monoclonal antibody conjugated via a MC linker to MMAF

Rabbit Anti-Mouse FLK-1/VEGFR-2 IgG #1, aff pure

FLK11-A 100 ug
EUR 578.4

Canadian Pesticide Mix 1 Containing 14 Compounds

CAN-CAN-1 1ML
EUR 98.04

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 153.6
Description: HIV-1 Tat Protein Peptide

FLT1 sgRNA CRISPR Lentivector (Human) (Target 1)

K0788102 1.0 ug DNA
EUR 184.8

Human Carbonic Anhydrase 14 (CA14) AssayMax ELISA Kit

EC5359-1 96 Well Plate
EUR 572.4

Human Genomic DNA 

X11000
  • Ask for price
  • EUR 235.40
  • 0.2 ml
  • 0.2 ml

PKI 14-22 amide, myristoylated

B9009-1 1 mg
EUR 321.6
Description: Myristoylated PKI (14-22) amide is an effective inhibitor of cAMP-dependent protein kinase (PKA) and blocks hyperalgesia produced by spinal administration of 8-bromo-cAMP. [1]PKAs are the major mediators of cAMP signaling in eukaryotes.

Calcitonin, Human (Synthetic peptide)

P1433-1
EUR 222

Methylation large sets of data provided via out-of-memory representation of the data to provide a responsive loading and analysis capabilities on machines with limited memory.

Results: We developed curatedTCGAData and cBioPortalData R / Bioconductor package to provide an integrated set of data from TCGA multiomic cBioPortal legacy database and web application programming interface using data structures MultiAssayExperiment. This suite of tools provides coordination experimental tests vary with clinicopathological the data with minimal data management burden, as demonstrated through several analysis multiomic pan-cancer and greatly simplified.

Conclusion: This representation allows analysts and developers integrated tools to apply statistical methods and a general plan for comprehensive multiomic data through user-friendly command and documented examples.

Related Posts

Leave a Reply

Your email address will not be published.