Role of implicit bias in pediatric cancer clinical trials and enrollment recommendations among pediatric oncology providers

Background: Provider implicit bias could negatively affect the doctor-patient communication. In this study, the authors measured implicit bias training in pediatric oncology providers and exposure implicit association test (IATs). They then assessed the association between IATs to race and socioeconomic status (SES) and the recommendation for the registration of clinical trials.

Methods: A prospective multisite study conducted to measure implicit bias among providers of oncology at the Hospital St. Jude Children’s Research and affiliated clinics. An IAT is used to assess the bias in the domain of race and SES. sketches of use cases to determine the relationship between bias and provider recommendation for trial registration. Data were analyzed using Student’s t test or Wilcoxon test for the comparison and the Jonckheere-Terpstra test is used for the association.

Results: Of the 105 number of the participants, 95 (90%) did not take an IAT and 97 (92%) do not have an implicit bias training before. A great effect was found for (bias towards) high SES (Cohen d, 1.93) and the European American race (Cohen d, 0.96). The majority of participants (90%) had a score sketch of 3 or 4, which indicates the recommendation for trial enrollment for part or the entire sketch. IAT and vignette scores did not significantly differ between providers on the Hospital St. Jude Children’s Research or affiliated clinics. No relationship was found between IAT and score sketches for the race (P = 0.58) or SES (P = 0.82).

Conclusions: The authors noted deficiencies prior exposure bias implicit self-assessment and training. Although providers show a preference for high SES and racial America Europe, this does not seem to affect the recommendation for registration of clinical trials that assessed by the sketch.

Through the years the ability to suppress angiogenesis has been utilized in the field of oncology. This efficiency is well documented and indications continue to grow, although the impact is often somewhat limited, as we argue in this review. Recent evidence suggests that angiogenesis inhibition may be a clinically meaningful treatment through several channels but less than the limit biomarker individual approach. The tumor microenvironment are anti-immune and anti-angiogenic drug combinations and immunotherapy has demonstrated impressive results and can change therapy in the years to come.

COVID-19 Pandemic Impact on Student and Resident Teaching and Training in Surgical Oncology

The COVID 19th pandemic has greatly changed the personal and professional interactions and behaviors worldwide. The effects of this pandemic and the measures taken have changed our health system, which in turn has affected the surgical medical education and training. In the face of constant interruption of surgical education and training during the pandemic outbreak, structured and innovative concepts and customized curriculum that is important to ensure the high quality of medical care. While efforts were made to prevent the virus from spreading, it is important to analyze and assess the impact of this crisis on medical education, surgical training and teaching in general and certainly in the field of surgical oncology.

Against this background, in this paper we introduce a practical and creative recommendations for the continuity of students and residents training and medical and surgical teaching. It includes a virtual curriculum of education, skill development classes, video-based feedback and simulation in the field of oncology surgical specialties. In conclusion, the effect COVID 19 Surgical Training and Teaching, certainly in the field of Surgical Oncology, challenging.

 Role of implicit bias in pediatric cancer clinical trials and enrollment recommendations among pediatric oncology providers
Role of implicit bias in pediatric cancer clinical trials and enrollment recommendations among pediatric oncology providers

Multiomic General Oncology Database Integration in Bioconductor

Objective: Investigation of the molecular basis for the development, progress and treatment of cancer are increasingly using complementary genomic tests to collect data multiomic, but the management and analysis of the data is still complex. The cBioPortal for genomics of cancer today provides data multiomic of> 260 general studies, including The Cancer Genome Atlas (TCGA) set of data, but the integration of various types of data the remains challenging and error prone to computational methods and tools to use these resources , The latest advances in data infrastructure in Bioconductor project enables new and powerful approach to creating this integrated representation multiomic, pan-cancer database

Methods: We provide a set of packages R / Bioconductor to work with legacy data and data TCGA cBioPortal, with special consideration for the loading time; efficient representation in and out of memory; Analytics platform; and integrative framework, as MultiAssayExperiment.

Human VEGFR-1/Flt1 ELISA Kit

EHV0045 96Tests
EUR 521

Bovine VEGFR-1/Flt1 ELISA Kit

EBV0045 96Tests
EUR 521

Anserini VEGFR-1/Flt1 ELISA Kit

EAV0045 96Tests
EUR 521

Canine VEGFR-1/Flt1 ELISA Kit

ECV0045 96Tests
EUR 521

Goat VEGFR-1/Flt1 ELISA Kit

EGTV0045 96Tests
EUR 521

Porcine VEGFR-1/Flt1 ELISA Kit

EPV0045 96Tests
EUR 521

Rabbit VEGFR-1/Flt1 ELISA Kit

ERTV0045 96Tests
EUR 521

Rat VEGFR-1/Flt1 ELISA Kit

ERV0045 96Tests
EUR 521

Mouse VEGFR-1/Flt1 ELISA Kit

EMV0045 96Tests
EUR 521

Anti-Flt1 Peptide

5-00708 4 x 5mg Ask for price

Anti-Flt1 Peptide

  • EUR 328.00
  • EUR 495.00
  • EUR 272.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Guinea Pig VEGFR-1/Flt1 ELISA Kit

EGV0045 96Tests
EUR 521

Anti-VEGF Receptor 1/FLT1 Antibody

A00534-1 100ug/vial
EUR 294

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-1 100ug/vial
EUR 294

VEGFR-2, human recombinant protein

P1080-.1 100 µg
EUR 1929
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

FLT1 Blocking Peptide

BF0131-BP 1mg
EUR 195

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0001 1.0mg
EUR 576
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0005 5.0mg
EUR 2207
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 280

Human Vascuoar endothelial cell growth factor receptor 1,VEGFR-1/Flt1 ELISA kit

201-12-0249 96 tests
EUR 440
  • This Vascuoar endothelial cell growth factor receptor 1 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) ELISA kit

CSB-E11885h-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) ELISA kit

  • EUR 678.00
  • EUR 4644.00
  • EUR 2467.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0265HM-48T 48T
EUR 289

Human Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0265HM-96T 96T
EUR 466

Human Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

QY-E00705 96T
EUR 361

Human FLT-1/VEGFR-1 Control/blocking peptide #1

FLT11-P 100 ug
EUR 164

anti- VEGFR-1/FLT-1 antibody

FNab09393 100µg
EUR 505.25
  • Recommended dilution: WB: 1:500 - 1:2000
  • IHC: 1:50 - 1:100
  • Immunogen: fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)
  • Uniprot ID: P17948
  • Gene ID: 2321
  • Research Area: Signal Transduction, Metab
  • Show more
Description: Antibody raised against VEGFR-1/FLT-1

Anti-VEGFR-1/FLT-1 antibody

PAab09393 100 ug
EUR 355

Anti-Peroxin 14 Antibody

A03327-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Peroxin 14 Antibody (PEX14) detection.tested for WB in Human, Mouse, Rat.

Anti-Cytokeratin 14

DB-099-1 1 ml
EUR 518
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

VEGFR Tyrosine Kinase Inhibitor II

C4603-1 1 mg
EUR 118

Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 ELISA kit

CSB-E04762m-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 ELISA kit

  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 ELISA Kit

CSB-E07350r-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 ELISA Kit

  • EUR 723.00
  • EUR 4883.00
  • EUR 2591.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0671RT-48T 48T
EUR 317

Rat Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0671RT-96T 96T
EUR 496

Mouse Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0125MS-48T 48T
EUR 336

Mouse Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

GA-E0125MS-96T 96T
EUR 534

Rat Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

QY-E10981 96T
EUR 361

Mouse Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit

QY-E21586 96T
EUR 361

anti-FLT1 (3D10)

LF-MA30315 100 ul
EUR 486
Description: Mouse Monoclonal to FLT1

Anti-FLT1 antibody

STJ111066 100 µl
EUR 277
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Anti-FLT1 antibody

STJ27575 100 µl
EUR 277
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Anti-FLT1 antibody

STJ112545 100 µl
EUR 277
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Anti-FLT1 antibody

STJ23673 100 µl
EUR 277
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Anti-FLT1 Antibody

STJ503482 100 µg
EUR 476

Anti-Siglec-5/14 Antibody

A06510-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Siglec-5/14 Antibody (SIGLEC5) detection.tested for IHC, WB in Human.

Rabbit Polyclonal antibody Anti-CRBN

Anti-CRBN 50 µg
EUR 349

VEGFR-1 Antibody

48347-100ul 100ul
EUR 333

VEGFR-1 Antibody

48347-50ul 50ul
EUR 239

Mouse FLK-1/VEGFR-2 control/blocking peptide # 1

FLK11-P 100 ug
EUR 164

Gastrin I (1-14) (human)

SP-100258-1 1 mg
EUR 164

Anti-14-3-3 epsilon Antibody

A01687-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for 14-3-3 epsilon Antibody (YWHAE) detection. Tested with WB, IHC in Mouse, Rat.

Anti-Cytokeratin 14 Rabbit Monoclonal Antibody

M01432-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Cytokeratin 14 Antibody. Validated in IP, IF, WB and tested in Human.

Anti-VEGF Receptor 1/FLT1 Antibody

A00534 100ug/vial
EUR 294

Anti-VEGF Receptor 1/FLT1 Antibody

PA1399 100ug/vial
EUR 294

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966 100ug/vial
EUR 294

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-2 100ug/vial
EUR 294

Gastrin Releasing Peptide (GRP) (14-27) (human, porcine, canine)

SP-100262-1 1 mg
EUR 286

Anti-FLT1 Antibody (Biotin)

STJ503483 100 µg
EUR 586

Anti-FLT1 Antibody (FITC)

STJ503484 100 µg
EUR 586

FLT1-D4 Vascular Endothelial Growth Factor Receptor-1 D4 Human Recombinant Protein

PROTP17948-1 Regular: 10ug
EUR 317
Description: Soluble FLT1 D1-4 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 457 amino acids and having a molecular mass of 55 kDa. The soluble receptor protein contains only the first 4 extracellular domains, which contain all the information necessary for binding of VEGF.;The VEGFR1 is purified by proprietary chromatographic techniques.

beta Amyloid (1-14) Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Somatostatin 28 (1-14) Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Adrenocorticotropic Hormone (1-14) Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Somatostatin-14 (7-14) Peptide

  • EUR 384.00
  • EUR 592.00
  • EUR 300.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Amyloid Beta Peptide 1-14 (Ab1-14) Antibody

abx411904-01ml 0.1 ml
EUR 509
  • Shipped within 1 week.

Anti-14-3-3 Rabbit Monoclonal Antibody

M02431-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal 14-3-3 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Mouse FLT-4/VEGFR-3 Control/blocking peptide #1

FLT41-P 100 ug
EUR 164

Rabbit Anti-human FLT-1/VEGFR-1 IgG #1, aff pure

FLT11-A 100 ul
EUR 482

VEGFR-1 / FLT-1 Antibody

abx239393-100ug 100 ug
EUR 481
  • Shipped within 5-12 working days.

TRAP-14 Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Peptide WE-14

H-8680.0001 1.0mg
EUR 441
Description: Sum Formula: C72H116N18O24S; CAS# [115136-18-0]

Peptide WE-14

H-8680.0005 5.0mg
EUR 1675
Description: Sum Formula: C72H116N18O24S; CAS# [115136-18-0]

Cortistatin 14

B5416-1 1 mg
EUR 250

TAT 14

B5721-1 1 mg
EUR 324

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

Anti-14-3-3 zeta/delta/YWHAZ Antibody

A01141-1 100ug/vial
EUR 334

DCIP-1, CXCL3, human

RC332-14 2ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT12-M 100 ug
EUR 482

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT14-M 100 ug
EUR 482

IGF-1, Insulin-like Growth factor-1, human

RC216-14 5mg
EUR 606.8
  • Product category: Proteins/Recombinant Proteins/Growth Factors

Human FLT-4/VEGFR-3 control/blocking peptide #2

FLT42-P 100 ug
EUR 164

Rat Vascuoar endothelial cell growth factor receptor 2(VEGFR-2/Flt1)ELISA Kit

GA-E0672RT-48T 48T
EUR 317

Rat Vascuoar endothelial cell growth factor receptor 2(VEGFR-2/Flt1)ELISA Kit

GA-E0672RT-96T 96T
EUR 496

Rat Vascuoar endothelial cell growth factor receptor 2(VEGFR-2/Flt1)ELISA Kit

QY-E10980 96T
EUR 361

Mouse Vascuoar endothelial cell growth factor receptor 2(VEGFR-2/Flt1)ELISA Kit

QY-E21587 96T
EUR 361

MIP-1 alpha, CCL3, human

RC315-14 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines

[Tyr12]-Somatostatin-28 (1-14) Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Anti-Peptide YY/PYY Antibody

A04223-1 100ug/vial
EUR 334

FLT1, human recombinant

EUR 294

FLT1, human recombinant

EUR 1811

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518

PTH, Parathyroid Hormone (1-34), human

RC412-14 20ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Hormones

Human Bombesin 1-14 aa full length peptide

BOM11-P 1 mg
EUR 286

anti-Caveolin-1 (Ab-14)

LF-PA20068 100 ul
EUR 334
Description: Rabbit polyclonal to Caveolin-1

Biotinylated-Mouse Monoclonal Anti-Human FLK-1/VEGFR-2 IgG # 3

FLK13-MB 100 ug
EUR 408

Polyclonal Goat anti-GST μ-form

GST-ANTI-2 50 uL
EUR 280

Polyclonal Goat anti-GST p-form

GST-ANTI-3 50 uL
EUR 280

Caspase-14 Blocking Peptide

EUR 153

BMP 14 Blocking Peptide

33R-10578 50 ug
EUR 349
Description: A synthetic peptide for use as a blocking control in assays to test for specificity of BMP 14 antibody, catalog no. 20R-1824

BMP-14 Blocking Peptide

EUR 153

Cytokeratin 14 Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Myosin 14 Blocking Peptide

  • EUR 286.00
  • EUR 425.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Cytokeratin 14 Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

GRP (14-27) Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Bombesin (8-14) Peptide

  • EUR 384.00
  • EUR 592.00
  • EUR 300.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Keratin 14 Blocking Peptide

AF0736-BP 1mg
EUR 195

Keratin 14 Blocking Peptide

AF5225-BP 1mg
EUR 195

Keratin 14 Blocking Peptide

AF5370-BP 1mg
EUR 195

Caspase-14 Blocking Peptide

AF9035-BP 1mg
EUR 195

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

Rabbit Anti-Mouse FLK-1/VEGFR-2 IgG #1, aff pure

FLK11-A 100 ug
EUR 482

Anti-FLT1 (Icrucumab)-SMCC-DM1 ADC

ADC-W-1148 1mg Ask for price
Description: This ADC product is comprised of an anti-FLT1 monoclonal antibody conjugated via a SMCC linker to DM1

Anti-FLT1 (Icrucumab)-SPDB-DM4 ADC

ADC-W-1149 1mg Ask for price
Description: This ADC product is comprised of an anti-FLT1 monoclonal antibody conjugated via a SPDB linker to DM4

Anti-FLT1 (Icrucumab)-MC-MMAF ADC

ADC-W-1150 1mg Ask for price
Description: This ADC product is comprised of an anti-FLT1 monoclonal antibody conjugated via a MC linker to MMAF

FLT1 protein

30R-2788 10 ug
EUR 353
Description: Purified recombinant Human FLT1 protein

Flt1 antibody

20R-FR013 50 ug
EUR 656
Description: Rabbit polyclonal Flt1 antibody

Flt1 antibody

20R-FR014 50 ug
EUR 656
Description: Rabbit polyclonal Flt1 antibody

FLT1 antibody

70R-17324 50 ul
EUR 435
Description: Rabbit polyclonal FLT1 antibody

FLT1 antibody

70R-13941 100 ug
EUR 322
Description: Affinity purified Rabbit polyclonal FLT1 antibody

Flt1 antibody

10R-1863 100 ul
EUR 403
Description: Mouse monoclonal Flt1 antibody

Flt1 antibody

10R-F117a 100 ug
EUR 716
Description: Mouse monoclonal Flt1 antibody

FLT1 Antibody

  • EUR 317.00
  • EUR 335.00
  • 100ug
  • 50ug
  • Form: Liquid
  • Buffer: Preservative: 0.03% Proclin 300
    Constituents: 50% Glycerol, 0.01M PBS, PH 7.4 >95%, Protein G purified
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC, IF; Recommended dilution: IHC:1:20-1:200, IF:1:50-1:200

FLT1 Antibody

EUR 335
  • Form: liquid
  • Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific
  • Show more
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;IHC:1:50-1:100

FLT1 Antibody

CSB-PA714296-100ul 100ul
EUR 316
  • Form: liquid
  • Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific
  • Show more
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;IHC:1:50-1:100

FLT1 Antibody

EUR 335
  • Form: liquid
  • Buffer: Supplied at 1.0mg/mL in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Antibodies were produced by immunizing rabbits with synthetic peptide and KLH conjugates. Antibo
  • Show more
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, WB;WB:1:500-1:1000

FLT1 Antibody

CSB-PA277480-100ul 100ul
EUR 316
  • Form: liquid
  • Buffer: Supplied at 1.0mg/mL in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Antibodies were produced by immunizing rabbits with synthetic peptide and KLH conjugates. Antibo
  • Show more
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, WB;WB:1:500-1:1000

FLT1 Antibody

BF0131 200ul
EUR 376
Description: FLT1 antibody detects endogenous levels of total FLT1.

FLT1 Antibody

  • EUR 222.00
  • EUR 195.00
  • 100ug
  • 50ug
  • Form: Liquid
  • Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;IHC:1/100-1/300.ELISA:1/10000

FLT1 Antibody

  • EUR 222.00
  • EUR 195.00
  • 100ug
  • 50ug
  • Form: Liquid
  • Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;IHC:1/100-1/300.ELISA:1/5000

FLT1 Antibody

  • EUR 597.00
  • EUR 333.00
  • 150ul
  • 50ul
  • Form: Liquid
  • Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20℃, Avoid freeze / thaw cycles. Antigen Affinity Purified
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: ELISA, WB


  • EUR 551.00
  • EUR 732.00
  • 15 nmol
  • 30 nmol
  • Shipped within 5-10 working days.


  • EUR 551.00
  • EUR 732.00
  • 15 nmol
  • 30 nmol
  • Shipped within 5-10 working days.


  • EUR 551.00
  • EUR 732.00
  • 15 nmol
  • 30 nmol
  • Shipped within 5-10 working days.

VEGFR-3 Antibody

21410-100ul 100ul
EUR 252

VEGFR-3 Antibody

21410-50ul 50ul
EUR 187

Vandetanib (VEGFR inhibitor)

SIH-483-10MG 10 mg
EUR 121
  • Vandetanib is a specific inhibitor of Flk-1 and Flt-4.
Description: The substance Vandetanib is a vegfr inhibitor. It is synthetically produced and has a purity of ?98%. The pure substance is yellow solid which is soluble in DMSO (30 mg/ml) or EtOH (10 mg/ml).

Vandetanib (VEGFR inhibitor)

SIH-483-50MG 50 mg
EUR 289
  • Vandetanib is a specific inhibitor of Flk-1 and Flt-4.
Description: The substance Vandetanib is a vegfr inhibitor. It is synthetically produced and has a purity of ?98%. The pure substance is yellow solid which is soluble in DMSO (30 mg/ml) or EtOH (10 mg/ml).

TSH (Thyrotrophin) ELISA test

14 96T/Box Ask for price
  • Area of application: Hormone testing
Description: ELISA based test for quantitative detection of TSH (Thyrotrophin)

Human Keratin 14 Differentiation Reporter (pGreenZeo, Plasmid)

SR10038PA-1 10 ug
EUR 1749
  • Category: Stem Cell Products

Human Keratin 14 Differentiation Reporter (pGreenZeo, Virus)

SR10038VA-1 >2 x 10^6 IFUs
EUR 755
  • Category: Stem Cell Products

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 398
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 511
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 404

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 556

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 387

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 532


EHV0018 96Tests
EUR 521

QuickDetect? VEGFR (Human) ELISA Kit

EUR 588

VEGFR-2, human recombinant protein

P1080-.01 10 µg
EUR 313
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

Human FLT1 ELISA Kit

ELA-E0147h 96 Tests
EUR 824

Human FLT1 shRNA Plasmid

  • EUR 801.00
  • EUR 1121.00
  • 150 µg
  • 300 µg
  • Shipped within 15-20 working days.

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 128
Description: HIV-1 Tat Protein Peptide

Anti-Cytokeratin 14

DB-099-0.1 100 μl
EUR 183
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Cytokeratin 14

DB-099-0.2 200 μl
EUR 255
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Cytokeratin 14

DB-099-0.5 500 μl
EUR 327
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Cytokeratin 14

DB-099-RTU-15 15 ml
EUR 302
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Cytokeratin 14

DB-099-RTU-7 7 ml
EUR 200
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Cytokeratin 14

DB099RTU-15 15 ml
EUR 302
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Cytokeratin 14

DB099RTU-7 7 ml
EUR 200
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

anti-Cytokeratin 14

YF-PA12883 50 ug
EUR 363
Description: Mouse polyclonal to Cytokeratin 14

anti-Cytokeratin 14

YF-PA12884 100 ug
EUR 403
Description: Rabbit polyclonal to Cytokeratin 14

anti-Claudin 14

YF-PA17953 50 ul
EUR 363
Description: Mouse polyclonal to Claudin 14

anti-Claudin 14

YF-PA17954 100 ul
EUR 403
Description: Rabbit polyclonal to Claudin 14

anti-Claudin 14

YF-PA17955 100 ug
EUR 403
Description: Rabbit polyclonal to Claudin 14

anti-Kallikrein 14

YF-PA18716 50 ul
EUR 363
Description: Mouse polyclonal to Kallikrein 14

anti-Kallikrein 14

YF-PA18717 50 ug
EUR 363
Description: Mouse polyclonal to Kallikrein 14


YF-PA18790 50 ul
EUR 363
Description: Mouse polyclonal to CGI-14


YF-PA18791 50 ug
EUR 363
Description: Mouse polyclonal to CGI-14

anti-Claudin 14

YF-PA25907 50 ul
EUR 334
Description: Mouse polyclonal to Claudin 14

anti-Caspase 14

YF-PA25909 50 ul
EUR 334
Description: Mouse polyclonal to Caspase 14

KRT14 Human, Cytokeratin 14 Human Recombinant Protein, His Tag

PROTP02533-1 Regular: 20ug
EUR 317
Description: KRT14 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 492 amino acids (1-472 a.a.) and having a molecular mass of 53.8kDa.;KRT14 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

FLT1 sgRNA CRISPR Lentivector (Human) (Target 1)

K0788102 1.0 ug DNA
EUR 154

Anti-Dimethyl Histone H3 (Lys9) Rabbit Monoclonal Antibody, Clone#RM151

M06819-14 100ug
EUR 473
Description: Anti-Dimethyl Histone H3 (Lys9) Rabbit Monoclonal Antibody, Clone#RM151 tested in WB, ELISA, Multiplex, ChIP, ICC, reactive to All Vertebrates

Human Carbonic Anhydrase 14 (CA14) AssayMax ELISA Kit

EC5359-1 96 Well Plate
EUR 477

Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure

FLT15-A 100 ul
EUR 482

PKI 14-22 amide, myristoylated

B9009-1 1 mg
EUR 268
Description: Myristoylated PKI (14-22) amide is an effective inhibitor of cAMP-dependent protein kinase (PKA) and blocks hyperalgesia produced by spinal administration of 8-bromo-cAMP. [1]PKAs are the major mediators of cAMP signaling in eukaryotes.

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein

PROTP01275-1 Regular: 50ug
EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

Ac-MBP (4-14) Peptide

5-00570 4 x 5mg Ask for price

Caspase 14 p10 Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Carbonic Anhydrase 14 Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Somatostatin-14 (2-9) Peptide

  • EUR 384.00
  • EUR 592.00
  • EUR 300.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Somatostatin-14 (3-10) Peptide

  • EUR 384.00
  • EUR 592.00
  • EUR 300.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

[Pyr4] MBP (4 14) Peptide

  • EUR 481.00
  • EUR 801.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Ac-MBP (4-14) Peptide

  • EUR 495.00
  • EUR 899.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

POTE-14/22 Blocking Peptide

AF9168-BP 1mg
EUR 195

Methylation large sets of data provided via out-of-memory representation of the data to provide a responsive loading and analysis capabilities on machines with limited memory.

Results: We developed curatedTCGAData and cBioPortalData R / Bioconductor package to provide an integrated set of data from TCGA multiomic cBioPortal legacy database and web application programming interface using data structures MultiAssayExperiment. This suite of tools provides coordination experimental tests vary with clinicopathological the data with minimal data management burden, as demonstrated through several analysis multiomic pan-cancer and greatly simplified.

Conclusion: This representation allows analysts and developers integrated tools to apply statistical methods and a general plan for comprehensive multiomic data through user-friendly command and documented examples.

Related Posts

Leave a Reply

Your email address will not be published. Required fields are marked *