Background: Provider implicit bias could negatively affect the doctor-patient communication. In this study, the authors measured implicit bias training in pediatric oncology providers and exposure implicit association test (IATs). They then assessed the association between IATs to race and socioeconomic status (SES) and the recommendation for the registration of clinical trials.
Methods: A prospective multisite study conducted to measure implicit bias among providers of oncology at the Hospital St. Jude Children’s Research and affiliated clinics. An IAT is used to assess the bias in the domain of race and SES. sketches of use cases to determine the relationship between bias and provider recommendation for trial registration. Data were analyzed using Student’s t test or Wilcoxon test for the comparison and the Jonckheere-Terpstra test is used for the association.
Results: Of the 105 number of the participants, 95 (90%) did not take an IAT and 97 (92%) do not have an implicit bias training before. A great effect was found for (bias towards) high SES (Cohen d, 1.93) and the European American race (Cohen d, 0.96). The majority of participants (90%) had a score sketch of 3 or 4, which indicates the recommendation for trial enrollment for part or the entire sketch. IAT and vignette scores did not significantly differ between providers on the Hospital St. Jude Children’s Research or affiliated clinics. No relationship was found between IAT and score sketches for the race (P = 0.58) or SES (P = 0.82).
Conclusions: The authors noted deficiencies prior exposure bias implicit self-assessment and training. Although providers show a preference for high SES and racial America Europe, this does not seem to affect the recommendation for registration of clinical trials that assessed by the sketch.
Through the years the ability to suppress angiogenesis has been utilized in the field of oncology. This efficiency is well documented and indications continue to grow, although the impact is often somewhat limited, as we argue in this review. Recent evidence suggests that angiogenesis inhibition may be a clinically meaningful treatment through several channels but less than the limit biomarker individual approach. The tumor microenvironment are anti-immune and anti-angiogenic drug combinations and immunotherapy has demonstrated impressive results and can change therapy in the years to come.
COVID-19 Pandemic Impact on Student and Resident Teaching and Training in Surgical Oncology
The COVID 19th pandemic has greatly changed the personal and professional interactions and behaviors worldwide. The effects of this pandemic and the measures taken have changed our health system, which in turn has affected the surgical medical education and training. In the face of constant interruption of surgical education and training during the pandemic outbreak, structured and innovative concepts and customized curriculum that is important to ensure the high quality of medical care. While efforts were made to prevent the virus from spreading, it is important to analyze and assess the impact of this crisis on medical education, surgical training and teaching in general and certainly in the field of surgical oncology.
Against this background, in this paper we introduce a practical and creative recommendations for the continuity of students and residents training and medical and surgical teaching. It includes a virtual curriculum of education, skill development classes, video-based feedback and simulation in the field of oncology surgical specialties. In conclusion, the effect COVID 19 Surgical Training and Teaching, certainly in the field of Surgical Oncology, challenging.
Role of implicit bias in pediatric cancer clinical trials and enrollment recommendations among pediatric oncology providers
Multiomic General Oncology Database Integration in Bioconductor
Objective: Investigation of the molecular basis for the development, progress and treatment of cancer are increasingly using complementary genomic tests to collect data multiomic, but the management and analysis of the data is still complex. The cBioPortal for genomics of cancer today provides data multiomic of> 260 general studies, including The Cancer Genome Atlas (TCGA) set of data, but the integration of various types of data the remains challenging and error prone to computational methods and tools to use these resources , The latest advances in data infrastructure in Bioconductor project enables new and powerful approach to creating this integrated representation multiomic, pan-cancer database
.
Methods: We provide a set of packages R / Bioconductor to work with legacy data and data TCGA cBioPortal, with special consideration for the loading time; efficient representation in and out of memory; Analytics platform; and integrative framework, as MultiAssayExperiment.
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity
This Vascuoar endothelial cell growth factor receptor 1 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Description: Quantitativesandwich ELISA kit for measuring Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Description: Quantitativesandwich ELISA kit for measuring Human vascular endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit
Description: Quantitativesandwich ELISA kit for measuring Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Description: Quantitativesandwich ELISA kit for measuring Rat Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Description: Quantitativesandwich ELISA kit for measuring Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Description: Quantitativesandwich ELISA kit for measuring Mouse Vascular endothelial cell growth factor receptor 1, VEGFR-1/Flt1 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Rat Vascuoar endothelial cell growth factor receptor 1(VEGFR-1/Flt1)ELISA Kit
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.
Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.
Description: Soluble FLT1 D1-4 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 457 amino acids and having a molecular mass of 55 kDa. The soluble receptor protein contains only the first 4 extracellular domains, which contain all the information necessary for binding of VEGF.;The VEGFR1 is purified by proprietary chromatographic techniques.
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).
Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;IHC:1/100-1/300.ELISA:1/10000
Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;IHC:1/100-1/300.ELISA:1/5000
Buffer: Supplied at 1.0mg/mL in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Antibodies were produced by immunizing rabbits with synthetic peptide and KLH conjugates. Antibo
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, WB;WB:1:500-1:1000
Buffer: Supplied at 1.0mg/mL in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Antibodies were produced by immunizing rabbits with synthetic peptide and KLH conjugates. Antibo
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, WB;WB:1:500-1:1000
Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;IHC:1:50-1:100
Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;IHC:1:50-1:100
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: ELISA, WB
Buffer: Preservative: 0.03% Proclin 300 Constituents: 50% Glycerol, 0.01M PBS, PH 7.4 >95%, Protein G purified
Description: A polyclonal antibody against FLT1. Recognizes FLT1 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC, IF; Recommended dilution: IHC:1:20-1:200, IF:1:50-1:200
Vandetanib is a specific inhibitor of Flk-1 and Flt-4.
Description: The substance Vandetanib is a vegfr inhibitor. It is synthetically produced and has a purity of ?98%. The pure substance is yellow solid which is soluble in DMSO (30 mg/ml) or EtOH (10 mg/ml).
Vandetanib is a specific inhibitor of Flk-1 and Flt-4.
Description: The substance Vandetanib is a vegfr inhibitor. It is synthetically produced and has a purity of ?98%. The pure substance is yellow solid which is soluble in DMSO (30 mg/ml) or EtOH (10 mg/ml).
Human Keratin 14 Differentiation Reporter (pGreenZeo, Plasmid)
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity
Description: KRT14 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 492 amino acids (1-472 a.a.) and having a molecular mass of 53.8kDa.;KRT14 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Description: Myristoylated PKI (14-22) amide is an effective inhibitor of cAMP-dependent protein kinase (PKA) and blocks hyperalgesia produced by spinal administration of 8-bromo-cAMP. [1]PKAs are the major mediators of cAMP signaling in eukaryotes.
GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.
Methylation large sets of data provided via out-of-memory representation of the data to provide a responsive loading and analysis capabilities on machines with limited memory.
Results: We developed curatedTCGAData and cBioPortalData R / Bioconductor package to provide an integrated set of data from TCGA multiomic cBioPortal legacy database and web application programming interface using data structures MultiAssayExperiment. This suite of tools provides coordination experimental tests vary with clinicopathological the data with minimal data management burden, as demonstrated through several analysis multiomic pan-cancer and greatly simplified.
Conclusion: This representation allows analysts and developers integrated tools to apply statistical methods and a general plan for comprehensive multiomic data through user-friendly command and documented examples.
ELISA Kit)
 ELISA kit)
ELISA Kit)
ELISA Kit)
)
 (human))
 (14-27) (human, porcine, canine))
)
)
 Peptide)
 Peptide)
 Peptide)
 Peptide)
 Antibody)
 (human))
, human)
ELISA Kit)
ELISA Kit)
 Peptide)
 ELISA test)
 (human))
 (human))
)
 Peptide)
 Peptide)
 (1-13), human)
 Rabbit Monoclonal Antibody, Clone#RM151)
-SMCC-DM1 ADC)
-SPDB-DM4 ADC)
-MC-MMAF ADC)
)
)
)
 ELISA Kit)
 (Target 1))
 AssayMax ELISA Kit)
 IgG, aff pure)
 Human Recombinant Protein)
)
 Peptide)
 Peptide)
 Peptide)
